KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0581Help
Entry
MYCMA_0581        CDS       T02177                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
mmv00040  Pentose and glucuronate interconversions
mmv00052  Galactose metabolism
mmv00500  Starch and sucrose metabolism
mmv00520  Amino sugar and nucleotide sugar metabolism
mmv01100  Metabolic pathways
mmv01130  Biosynthesis of antibiotics
Module
mmv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYCMA_0581
   00052 Galactose metabolism
    MYCMA_0581
   00500 Starch and sucrose metabolism
    MYCMA_0581
   00520 Amino sugar and nucleotide sugar metabolism
    MYCMA_0581
Enzymes [BR:mmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MYCMA_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: AFN62746
Position
complement(3672001..3672930)
Genome map
AA seq 309 aa AA seqDB search
MTGPDVLIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAEEAAEAGAERLVI
VTSEGKDGVVAHFVEDLVLEGTLEARGKHAMLEKVRKAPALIKVQSVVQAEPLGLGHAVG
CVESVLDDDEDAVAVLLPDDLVWPRGVLETMAKVRAKRGGSVLCAIEVPPHEISSYGAFD
VEIVPDAANPNVLRVKGMVEKPKPEEAPSNYAAAGRYLLDRAIFDALKRIPRGAGGELQL
TDAIALLIDEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPGLREWLVERLGR
ESSVLPESE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacctgacgtgttgattccccgaaccgcggttgtgcccgcggcgggcctgggc
acccggttcctgccggccaccaagacggtgcccaaggagctgcttccggtggtcgacacc
cccggaatcgaactggtggccgaggaggccgccgaggccggcgccgaacgtttggtgatc
gtcacctccgagggcaaggacggcgtcgtcgcgcacttcgtcgaggacttggtgctggaa
ggcacactcgaggcgcgcggtaaacacgccatgctcgaaaaggtgcgcaaggctccggcg
ctcatcaaggtgcagtcggtggtgcaggccgagccgttggggctggggcatgcggtggga
tgcgtggagtcggttctcgacgacgacgaggatgccgtcgcagtactgctaccggacgat
ctggtgtggccacgcggcgtgctggagaccatggccaaggtgcgggccaaacgcggcggc
tcggtgctgtgcgccatcgaggtgcccccgcacgagatcagctcctacggtgcgttcgat
gtcgagatcgtgcccgacgccgcgaacccgaatgttctgcgtgtcaagggaatggttgag
aagccaaagcccgaggaagcaccctcgaactacgcggcggccggccgctacctgctagat
cgcgcgattttcgacgcgctcaagcggatcccgcgcggggccggcggcgagctgcagctc
accgacgccatcgctttgttgatcgacgaggggcatccggtgcatgttgtggtgcaccgc
ggatcccgacacgacctgggaaatcccggcggctatctcaaggctgctgttgactttgcg
ttggatcgcgacgattacggtccgggcttgcgggagtggctggtcgagcggctcggccgg
gaatcgtccgtgctgccggagtcggagtaa

DBGET integrated database retrieval system