KEGG   Mycobacterium massiliense: MYCMA_0581Help
Entry
MYCMA_0581        CDS       T02177                                 

Gene name
yngB
Definition
UTP--glucose-1-phosphate uridylyltransferase yngB (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmv  Mycobacterium massiliense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYCMA_0581 (yngB)
   00052 Galactose metabolism
    MYCMA_0581 (yngB)
   00500 Starch and sucrose metabolism
    MYCMA_0581 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    MYCMA_0581 (yngB)
Enzymes [BR:mmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MYCMA_0581 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098898..1099827
Genome map
AA seq 309 aa AA seqDB search
MTGPDVLIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAEEAAEAGAERLVI
VTSEGKDGVVAHFVEDLVLEGTLEARGKHAMLEKVRKAPALIKVQSVVQAEPLGLGHAVG
CVESVLDDDEDAVAVLLPDDLVWPRGVLETMAKVRAKRGGSVLCAIEVPPHEISSYGAFD
VEIVPDAANPNVLRVKGMVEKPKPEEAPSNYAAAGRYLLDRAIFDALKRIPRGAGGELQL
TDAIALLIDEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPGLREWLVERLGR
ESSVLPESE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacctgacgtgttgattccccgaaccgcggttgtgcccgcggcgggcctgggc
acccggttcctgccggccaccaagacggtgcccaaggagctgcttccggtggtcgacacc
cccggaatcgaactggtggccgaggaggccgccgaggccggcgccgaacgtttggtgatc
gtcacctccgagggcaaggacggcgtcgtcgcgcacttcgtcgaggacttggtgctggaa
ggcacactcgaggcgcgcggtaaacacgccatgctcgaaaaggtgcgcaaggctccggcg
ctcatcaaggtgcagtcggtggtgcaggccgagccgttggggctggggcatgcggtggga
tgcgtggagtcggttctcgacgacgacgaggatgccgtcgcagtactgctaccggacgat
ctggtgtggccacgcggcgtgctggagaccatggccaaggtgcgggccaaacgcggcggc
tcggtgctgtgcgccatcgaggtgcccccgcacgagatcagctcctacggtgcgttcgat
gtcgagatcgtgcccgacgccgcgaacccgaatgttctgcgtgtcaagggaatggttgag
aagccaaagcccgaggaagcaccctcgaactacgcggcggccggccgctacctgctagat
cgcgcgattttcgacgcgctcaagcggatcccgcgcggggccggcggcgagctgcagctc
accgacgccatcgctttgttgatcgacgaggggcatccggtgcatgttgtggtgcaccgc
ggatcccgacacgacctgggaaatcccggcggctatctcaaggctgctgttgactttgcg
ttggatcgcgacgattacggtccgggcttgcgggagtggctggtcgagcggctcggccgg
gaatcgtccgtgctgccggagtcggagtaa

DBGET integrated database retrieval system