KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0603Help
Entry
MYCMA_0603        CDS       T02177                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYCMA_0603
Enzymes [BR:mmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MYCMA_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3638129..3639112)
Genome map
AA seq 327 aa AA seqDB search
MSAIRAAERTLRGVSETVSDWVPTGAVTVRAPGKVNLYLAVGDLRGDGYHELTTVFHAVS
LADDVTVRDADVLSVDVVGQGEGTVPTDDRNLAWQAAELFADHVGRAPDVSIFINKDIPV
AGGMAGGSADAAGVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQL
ATVLARSVFHWVFAFADGGLSTPQVFKEIDRLRENGDPPRLAEPDELLGALAAGDARRLA
PLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELA
GAGVCRTVRVASGPVHGAQVIQGRSDG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccattcgcgccgcagaacgtaccctcaggggcgtgtccgagaccgtctccgat
tgggttcctaccggcgcggtgaccgtccgggcacccggcaaggtcaatctgtacctggcc
gtaggtgacctccgtggcgacggctatcacgagctgaccacggtttttcacgccgtttca
ctggccgacgatgtaaccgtgcgggacgccgacgtgttatcggtcgatgtggtcgggcag
ggcgagggcaccgtacccaccgacgaccgcaatctcgcctggcaggccgccgagcttttc
gccgatcatgtgggccgcgcccccgacgtctcgatcttcattaataaggacatccccgtc
gcgggcggtatggccggcggatctgccgatgccgctggagtgttggtggccatgaacgag
ctctggcatgccggtgtgccgcgccgggacctgcaccacctggccgctcagctcggcagc
gatgtcccgtttgccttgcatggcggcaccgcgctgggcaccggccggggcgagcagctg
gccacggtgctggcacgtagcgtctttcattgggtgttcgcgttcgcagacgggggactg
tcgacgccccaggtcttcaaggagatcgaccggctgcgtgagaacggcgatccgccgcgg
ctcgccgagccggatgaacttttgggtgcgctcgccgccggggacgcgcgccggctggca
cccctgctcggtaacgaattgcaggccgcggcggtcagcttgaaccccgaattgcggcgc
acgctgcgggcaggggagtcggcgggcgctctggccggaatcgtctccgggtcgggtcct
acctgcgcgttcttgtgcacctcggccgacgatgcggtgcaggtgagcgcggagctggcg
ggcgcgggggtgtgccgcaccgtgcgggtggccagcggacccgtgcacggtgcacaggtc
attcagggccgcagcgacggctga

DBGET integrated database retrieval system