KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0630Help
Entry
MYCMA_0630        CDS       T02177                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
mmv00071  Fatty acid degradation
mmv00280  Valine, leucine and isoleucine degradation
mmv00281  Geraniol degradation
mmv00310  Lysine degradation
mmv00360  Phenylalanine metabolism
mmv00362  Benzoate degradation
mmv00380  Tryptophan metabolism
mmv00410  beta-Alanine metabolism
mmv00627  Aminobenzoate degradation
mmv00640  Propanoate metabolism
mmv00650  Butanoate metabolism
mmv00903  Limonene and pinene degradation
mmv00930  Caprolactam degradation
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
mmv01130  Biosynthesis of antibiotics
mmv01212  Fatty acid metabolism
Module
mmv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCMA_0630
   00650 Butanoate metabolism
    MYCMA_0630
  Lipid metabolism
   00071 Fatty acid degradation
    MYCMA_0630
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCMA_0630
   00310 Lysine degradation
    MYCMA_0630
   00360 Phenylalanine metabolism
    MYCMA_0630
   00380 Tryptophan metabolism
    MYCMA_0630
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCMA_0630
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYCMA_0630
   00281 Geraniol degradation
    MYCMA_0630
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYCMA_0630
   00627 Aminobenzoate degradation
    MYCMA_0630
   00930 Caprolactam degradation
    MYCMA_0630
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYCMA_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AFN62791
Position
3592357..3593388
Genome map
AA seq 343 aa AA seqDB search
MTDQIETRVDKGVGLLTLNRPKAINSLTYDMIAAMSAVLAEWEADDAVRAVVLSGAGERG
LCAGGDVVAVHDSAKIDGVAARRFFRDEYVLNAQIARFPKPYVALMDGIVMGGGVGVGGH
ANTRIVTDTSKVAMPEVGIGFIPDVGGTYLLSRAPGQLGLHAALTGAPFSGADAIALGFA
DHYVPHDRLEKFTKAIIDSDIATALAVHGTSAPSSDLLAQRNWIDECYAGESVADIVAAL
QARGDERARAAADQILTRSPIALSVTLAAVRRARELPSLEAVLTQEYRVSSQSVRSHDLV
EGIRAQLVDKDRNPQWVPKTLAEVTKADVEEFFQPVGDDLEWP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatcagatcgaaacccgggtcgacaagggggtcggcctgctgacgctgaaccgt
cccaaggccatcaactcactcacctacgacatgatcgcggcgatgagcgccgtcctggcg
gagtgggaggctgacgacgcggtacgcgcggtcgtgctttcgggcgccggcgagcgtggt
ctgtgcgccggcggcgacgtggtggccgtgcacgacagcgccaagatcgacggcgtggca
gcccgcaggttcttccgcgacgagtacgtgctcaacgcacagatcgcgcgcttcccgaaa
ccgtatgtggcgctgatggacggcatcgtgatgggcggcggtgtcggagtcggcgggcat
gccaacacccgcattgtcaccgatacctcaaaggtggcgatgccggaggtgggcatcggc
ttcatcccggacgtgggcggtacctacctgctctcgcgtgcccccggccagctcggctta
cacgccgcactcacgggtgcgcccttctccggagccgacgccatcgcactgggcttcgcc
gaccactacgtgccgcatgaccggctcgaaaagttcaccaaggccatcatcgatagcgat
atcgccactgcgcttgcggtccacggcaccagcgcaccgtcgagtgatctgctggctcaa
cgaaattggatcgacgagtgctacgccggtgaatccgtcgccgatatcgtcgccgcgctg
caagcccgcggtgacgaacgggcacgcgcggcagccgatcaaatcctgacccgctccccc
atcgcactgtcggtgacgcttgcggcagtgcgcagggctcgcgaactgccgtcgctggaa
gcggttctcacccaggaatatcgagtgtccagccaatcggtgcgctcgcatgatctggtc
gagggcatcagggctcagctggtcgacaaggatcgcaacccgcagtgggttcctaagaca
ctcgccgaggtcaccaaggccgatgtcgaggagttcttccagccggtcggcgacgacttg
gagtggccatga

DBGET integrated database retrieval system