KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0661Help
Entry
MYCMA_0661        CDS       T02177                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MYCMA_0661 (choD)
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MYCMA_0661 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1244333..1246015)
Genome map
AA seq 560 aa AA seqDB search
MDYDYDVVVIGSGFGGSVAALRLTEKGYRVGVLDMGKRWKREDFPPNNWHVRKAMWAPAL
GCYGPQRLTVLGKTFIASAVGVGGGSLIYGNTLYEPLEQFYVDKQWAHISDWKSELAPYY
DQASRMLGVAQTPHTTPPDEVLLAVAKDLGVEHTYHPTNVGVFFGDEPGKTVPDPFFGGA
GPERTGCIGCAACMTGCKHNAKNTTETNYLYLAEHAGAQIHPLTQVLDVRPLEDGEGYAV
STKQTGRLLRKKKRTFTAQHVVFSAASLGTQRLLHKFKDSGSLPNLSERLGEQTRTNSES
VPIVYSPTRDDFSQGVAITSSIHPEPNTHVEVVRYGEGSTFLSMLGTNMVDGGPWRFART
WLANLRHPAMMFRSMFPYRAAQHSIIVLVMQSLDNSLTTYLKRGMFGKKMTAKQGSGEPN
PDWIPVAHDVARRMADKVDGYAGSTHLDSMNIPLTAHFIGGCPIGDSPETGVIDPYQRIY
GHPGLHICDGSAISANLGVNPSFTITAQAERAMAFWPNKGEADPRPPLGSAYQRVAPVQP
NHPTVPESAPGALRLPLTPV
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggactatgactacgacgtagtcgtcatcgggtccggtttcggtgggagcgttgcggcc
ctccgcctcaccgaaaagggctaccgagtcggcgtattggacatgggaaaacgttggaaa
cgcgaagatttcccaccgaataactggcacgtgcgcaaggcgatgtgggcaccggcgctg
ggctgttacggcccccaacgtctcacggttctcggcaagaccttcatcgccagcgcagtg
ggtgtgggtggcggctcgctgatctacggcaacaccctctacgagccgttggagcagttt
tacgtcgacaagcagtgggcgcatatcagcgactggaagtccgagctggctccgtattac
gaccaggccagccgcatgctgggtgtcgcacagactccgcacaccaccccacccgacgag
gtgctgttggcggtggccaaggatctgggcgtcgagcacacctatcaccccaccaacgtg
ggcgtcttcttcggcgacgagcccggcaagacggtgcccgacccgttcttcggcggcgcc
ggacccgagcgcacgggttgtatcggatgcgcggcctgtatgaccggctgcaagcacaac
gccaagaacaccaccgagaccaactatctctatctcgccgaacacgctggcgcacagatc
catccgttgacccaggttctcgacgtccgcccgctggaagacggtgagggatacgcggtc
agtaccaagcaaaccgggcgactgttacgcaagaagaagcgcacgttcaccgcgcagcat
gtggtgttctcggcggcgtcgctgggcacccagcgactgctgcacaaattcaaggactcg
ggctcgctgcccaatctgtcggagcgcctgggagaacagacgcgcaccaactccgaatca
gtgcctatcgtctactcccctacccgtgacgacttctcgcagggagtcgccatcacatcg
tcaatccaccccgaacccaacacccatgtcgaagtggtccggtatggggagggatcgacg
ttcctgagcatgttgggcaccaatatggtcgacggcggcccgtggcgtttcgcacgaacc
tggctagcgaacctgcggcaccccgcgatgatgttccggtcgatgtttccctaccgtgcc
gcgcagcactccatcatcgtgttggtgatgcagtcgttggacaactcgctgaccacctac
ctcaaacgcggaatgttcggcaagaagatgaccgcgaaacagggttccggagaaccgaat
ccggactggatcccggtggcccacgatgtcgcacgccgtatggccgacaaggtcgacgga
tacgcgggcagtacgcatctggattcgatgaacatcccgctgacggcgcatttcatcggt
ggttgccccatcggcgattcgcccgagacgggggtgatcgacccgtaccaacgaatctac
ggccatcccggtctacatatctgcgatggatcggcgatctcggcgaacctgggagtgaac
ccgtcgttcaccatcaccgcacaggccgagcgcgccatggcgttctggcccaacaagggc
gaggccgatccacgcccgccgctgggctcggcataccagcgcgtcgcgccggtgcagccg
aaccacccgacggttcccgagtccgcacccggtgcgctgcgcttgccgttgacaccggtc
tga

DBGET integrated database retrieval system