KEGG   Mycobacterium massiliense: MYCMA_0661Help
Entry
MYCMA_0661        CDS       T02177                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mmv  Mycobacterium massiliense
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:mmv00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1244333..1246015)
Genome map
AA seq 560 aa AA seqDB search
MDYDYDVVVIGSGFGGSVAALRLTEKGYRVGVLDMGKRWKREDFPPNNWHVRKAMWAPAL
GCYGPQRLTVLGKTFIASAVGVGGGSLIYGNTLYEPLEQFYVDKQWAHISDWKSELAPYY
DQASRMLGVAQTPHTTPPDEVLLAVAKDLGVEHTYHPTNVGVFFGDEPGKTVPDPFFGGA
GPERTGCIGCAACMTGCKHNAKNTTETNYLYLAEHAGAQIHPLTQVLDVRPLEDGEGYAV
STKQTGRLLRKKKRTFTAQHVVFSAASLGTQRLLHKFKDSGSLPNLSERLGEQTRTNSES
VPIVYSPTRDDFSQGVAITSSIHPEPNTHVEVVRYGEGSTFLSMLGTNMVDGGPWRFART
WLANLRHPAMMFRSMFPYRAAQHSIIVLVMQSLDNSLTTYLKRGMFGKKMTAKQGSGEPN
PDWIPVAHDVARRMADKVDGYAGSTHLDSMNIPLTAHFIGGCPIGDSPETGVIDPYQRIY
GHPGLHICDGSAISANLGVNPSFTITAQAERAMAFWPNKGEADPRPPLGSAYQRVAPVQP
NHPTVPESAPGALRLPLTPV
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggactatgactacgacgtagtcgtcatcgggtccggtttcggtgggagcgttgcggcc
ctccgcctcaccgaaaagggctaccgagtcggcgtattggacatgggaaaacgttggaaa
cgcgaagatttcccaccgaataactggcacgtgcgcaaggcgatgtgggcaccggcgctg
ggctgttacggcccccaacgtctcacggttctcggcaagaccttcatcgccagcgcagtg
ggtgtgggtggcggctcgctgatctacggcaacaccctctacgagccgttggagcagttt
tacgtcgacaagcagtgggcgcatatcagcgactggaagtccgagctggctccgtattac
gaccaggccagccgcatgctgggtgtcgcacagactccgcacaccaccccacccgacgag
gtgctgttggcggtggccaaggatctgggcgtcgagcacacctatcaccccaccaacgtg
ggcgtcttcttcggcgacgagcccggcaagacggtgcccgacccgttcttcggcggcgcc
ggacccgagcgcacgggttgtatcggatgcgcggcctgtatgaccggctgcaagcacaac
gccaagaacaccaccgagaccaactatctctatctcgccgaacacgctggcgcacagatc
catccgttgacccaggttctcgacgtccgcccgctggaagacggtgagggatacgcggtc
agtaccaagcaaaccgggcgactgttacgcaagaagaagcgcacgttcaccgcgcagcat
gtggtgttctcggcggcgtcgctgggcacccagcgactgctgcacaaattcaaggactcg
ggctcgctgcccaatctgtcggagcgcctgggagaacagacgcgcaccaactccgaatca
gtgcctatcgtctactcccctacccgtgacgacttctcgcagggagtcgccatcacatcg
tcaatccaccccgaacccaacacccatgtcgaagtggtccggtatggggagggatcgacg
ttcctgagcatgttgggcaccaatatggtcgacggcggcccgtggcgtttcgcacgaacc
tggctagcgaacctgcggcaccccgcgatgatgttccggtcgatgtttccctaccgtgcc
gcgcagcactccatcatcgtgttggtgatgcagtcgttggacaactcgctgaccacctac
ctcaaacgcggaatgttcggcaagaagatgaccgcgaaacagggttccggagaaccgaat
ccggactggatcccggtggcccacgatgtcgcacgccgtatggccgacaaggtcgacgga
tacgcgggcagtacgcatctggattcgatgaacatcccgctgacggcgcatttcatcggt
ggttgccccatcggcgattcgcccgagacgggggtgatcgacccgtaccaacgaatctac
ggccatcccggtctacatatctgcgatggatcggcgatctcggcgaacctgggagtgaac
ccgtcgttcaccatcaccgcacaggccgagcgcgccatggcgttctggcccaacaagggc
gaggccgatccacgcccgccgctgggctcggcataccagcgcgtcgcgccggtgcagccg
aaccacccgacggttcccgagtccgcacccggtgcgctgcgcttgccgttgacaccggtc
tga

DBGET integrated database retrieval system