KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0706Help
Entry
MYCMA_0706        CDS       T02177                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
mmv00300  Lysine biosynthesis
mmv01100  Metabolic pathways
mmv01120  Microbial metabolism in diverse environments
mmv01230  Biosynthesis of amino acids
Module
mmv_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MYCMA_0706
Enzymes [BR:mmv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MYCMA_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFN62867
Position
complement(3456182..3457246)
Genome map
AA seq 354 aa AA seqDB search
MALELAGDPIALTAALVDIPSESRHEAQIADAVEVALREQTSGFEVIRNGNAVLARTNNG
LGTRVMLAGHLDTVPAADNVPSRHEGEILHGCGTVDMKSGDAVFLHLAATVTPRVDLTLV
FYDCEEIESSANGLGRIERELPDWLDADLAILGEPTAGLIEAGCQGTLRVVIRTGGTRAH
SARSWLGDNAIHKLAAVLDRLAAYQARIVDIDGCQYREGLSAVRIDGGVAGNVIPDAAAV
TVNFRFAPDRSPEQALVHVHEVFDGLDVQIELTDSAAGALPGLDRPAAAELVGAAGGAVR
AKYGWTDVSRFAARGIAAVNYGPGDPNLAHTRGEHVPVQQITAVTEVLRRYLTV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcttgaactcgctggtgacccgatcgccctgacggctgccctggtagacatcccc
agtgagtcccgtcacgaggcccagatcgccgatgcggtcgaggtggcgctgcgggaacag
accagtggtttcgaggtcatccgcaacggcaacgcggtgctggcccgtacgaataacgga
ctcggtacccgggtcatgctggccgggcacctggataccgtgcccgccgccgataacgtg
cccagccggcacgagggagagatcctgcacggctgcggcaccgtcgacatgaaatccggg
gacgccgtattcctgcatctggccgccaccgtgacaccccgggtggaccttacgctggtg
ttctacgactgcgaggagatcgagtcctcggccaacgggctgggccgcatcgaacgcgaa
ctgcccgactggctcgacgccgacctggccatcctgggcgagccgaccgccggactcatc
gaagcgggctgtcagggcaccctgcgggtcgtcatccggaccgggggcacccgcgcgcac
tcggcgagatcctggctgggggacaacgccattcacaaactggctgctgtactggacagg
ctggccgcgtaccaggcgcgcatcgtcgatatcgacggctgtcagtatcgggaaggattg
tccgcggtacggatcgatggcggagtcgccgggaacgtgattcccgatgcggcggcggtc
accgtgaacttccggttcgctcccgatcgcagccccgagcaggcgctcgtgcacgtgcat
gaggtattcgacgggctcgacgtccagatcgaactcaccgactcggccgccggagcgctg
cccggcctggaccgtcccgccgccgccgaattggtcggtgcggcagggggagcggtgcgg
gcgaagtatggctggaccgacgtgtcccggttcgcggcgcgcggtatcgccgcggtcaac
tacgggcccggcgatcccaacttggcacatacccgcggcgaacacgttcccgtccagcag
atcaccgccgtcaccgaggtacttcgccgttatctcaccgtgtga

DBGET integrated database retrieval system