KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0712Help
Entry
MYCMA_0712        CDS       T02177                                 

Gene name
folP2
Definition
inactive dihydropteroate synthase 2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCMA_0712 (folP2)
Enzymes [BR:mmv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MYCMA_0712 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347205..1348080
Genome map
AA seq 291 aa AA seqDB search
MRETFCGRPVRTDRALIMAIVNRTPDSFYDRGATFTDEAAQAAVHQAVADGADVVDIGGV
KAGPGENVDAAAETARVVPFIEWVRGAHPDLLISVDTWRAEVAAKACAAGADLINDTWAG
ADPELPAVAAAHGAGLVCSHTGGAVPRTRPYRVHYGTEVDGVVRAVLDEVTASAERAMAL
GVSKDAILIDPTHDFGKNTFHGLALLRHVNDLVNTGWPVLMALSNKDFIGETLGVGLTER
LEGTLAATALAAAAGARMFRVHEVGPTRRTLEMVGSIVGTRPPARTVRGLA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagacgttttgtggacgacccgtccgcaccgatcgtgctctcatcatggcgatc
gtgaaccgcacaccggactcgttctatgaccgcggtgccacctttaccgacgaggcggcc
caggccgcggtgcatcaagcggtggccgacggtgcggatgtcgtcgacatcggtggcgtc
aaggcgggcccgggagagaacgtcgacgccgccgccgaaaccgcgcgggtggtgcccttc
atcgaatgggtgcgcggcgcccaccccgacttgctgatcagtgtggatacctggcgcgcc
gaggttgcggcgaaggcctgcgcggcaggagccgatctgatcaacgacacctgggcgggt
gccgatcccgagctaccggccgtggcggccgcgcacggcgccggattggtttgctcacac
accggtggcgcggtgccgcgtacccggccgtatcgcgtccactacggaactgaggtcgac
ggcgtcgtgcgggcggtgctcgacgaagtgaccgcgtccgccgagcgggcgatggctctg
ggggtgtcaaaggacgcgattctgatcgatccgacgcatgacttcggcaaaaacaccttc
cacgggctcgctttgttgcgccacgtaaacgatctcgttaataccgggtggcccgtgttg
atggcgttgagcaacaaggatttcatcggggagactcttggtgtgggactgacggaacga
ctcgagggcactctcgccgcgaccgcactggcggctgctgcgggtgctcgcatgttccgg
gttcatgaggttgggcccacacgccgcacgctggaaatggtgggctccatcgtcgggacc
cgcccaccggcgcgaacagtgagggggttggcatga

DBGET integrated database retrieval system