KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_0766Help
Entry
MYCMA_0766        CDS       T02177                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00260  Glycine, serine and threonine metabolism
mmv00750  Vitamin B6 metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
mmv01230  Biosynthesis of amino acids
Module
mmv_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCMA_0766
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MYCMA_0766
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MYCMA_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFN62926
Position
complement(3358127..3359194)
Genome map
AA seq 355 aa AA seqDB search
MTVHTPWPGLIAAYRDRLPIGENWQPVTLREGGTPLLPAARLSELTGCTVHLKVEGLNPT
GSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAAKAGITCAVLIPQGKIAMGKL
AQAVIHGARIIQVDGNFDDCLELARKTTADYPTIALVNSVNPVRIEGQKTAAFEIMDALG
TAPDIHALPVGNAGNITAYWRGYNEYYRDGLSDRLPKMLGAQAAGAAPLVNGAPVANPET
IATAIRIGSPASWSGAVAAQQESDGKFLAVTDEEILNAYRLVASSEGVFVEPASAASIAG
LLKSVADGWVAKGSTVVCTVTGNGLKDPDNALSGMPEVTPIPVQASAVAEALELA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgacagttcataccccgtggcccggcctcatcgccgcttaccgcgaccgtctcccgatc
ggtgagaactggcagccggtgaccctgcgtgagggcggcacgccgttgctccccgcggcg
cgtctttccgagctcaccggatgcaccgtgcacctgaaggttgaaggcctgaaccccacc
gggtcgttcaaggaccgtggtatgaccatggccgtgaccgacgcgctggcgcgcggccag
cgcgcggtgctgtgcgcctcgaccgggaacacctcggcctcggccgccgcatatgcggcc
aaggcgggtatcacgtgtgctgtattgattccgcagggcaagatcgcgatgggcaagttg
gcccaggctgtcatccacggtgcgcggatcatccaggtagacggcaattttgatgactgt
ctggagctggcgcgcaagaccacggcggattatccgaccattgcgctggtgaactcggtg
aatccggtgcgtatcgaggggcagaagaccgctgccttcgagatcatggatgcgctcggc
accgcccccgatatccacgcgctgccggtcggcaacgccgggaacatcaccgcgtactgg
cgcggctacaacgagtactaccgtgacggcctgtcggaccgcctgcccaagatgctgggt
gctcaggccgccggcgccgcaccgctggtcaacggggcgcctgtcgccaatccggagacc
atcgccaccgccatccggatcggatctcccgcttcgtggtcgggcgcggttgccgcgcaa
caggaatcggacggcaagttcctggccgtcaccgatgaggagattctcaacgcctaccgg
ctggtcgcatccagcgagggcgtgttcgtggagcccgcgtcggcagccagcatcgcgggc
ctgctgaaatcggtcgccgacggctgggttgccaagggttccaccgtggtctgcaccgtg
acgggcaacggcctgaaggatcccgataatgcgctgagcggaatgcccgaggtgactccc
atcccggtccaggcgagtgccgtcgccgaggcgctggaactggcgtga

DBGET integrated database retrieval system