KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0766Help
Entry
MYCMA_0766        CDS       T02177                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCMA_0766 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCMA_0766 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MYCMA_0766 (thrC)
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MYCMA_0766 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1441821..1442888
Genome map
AA seq 355 aa AA seqDB search
MTVHTPWPGLIAAYRDRLPIGENWQPVTLREGGTPLLPAARLSELTGCTVHLKVEGLNPT
GSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAAKAGITCAVLIPQGKIAMGKL
AQAVIHGARIIQVDGNFDDCLELARKTTADYPTIALVNSVNPVRIEGQKTAAFEIMDALG
TAPDIHALPVGNAGNITAYWRGYNEYYRDGLSDRLPKMLGAQAAGAAPLVNGAPVANPET
IATAIRIGSPASWSGAVAAQQESDGKFLAVTDEEILNAYRLVASSEGVFVEPASAASIAG
LLKSVADGWVAKGSTVVCTVTGNGLKDPDNALSGMPEVTPIPVQASAVAEALELA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgacagttcataccccgtggcccggcctcatcgccgcttaccgcgaccgtctcccgatc
ggtgagaactggcagccggtgaccctgcgtgagggcggcacgccgttgctccccgcggcg
cgtctttccgagctcaccggatgcaccgtgcacctgaaggttgaaggcctgaaccccacc
gggtcgttcaaggaccgtggtatgaccatggccgtgaccgacgcgctggcgcgcggccag
cgcgcggtgctgtgcgcctcgaccgggaacacctcggcctcggccgccgcatatgcggcc
aaggcgggtatcacgtgtgctgtattgattccgcagggcaagatcgcgatgggcaagttg
gcccaggctgtcatccacggtgcgcggatcatccaggtagacggcaattttgatgactgt
ctggagctggcgcgcaagaccacggcggattatccgaccattgcgctggtgaactcggtg
aatccggtgcgtatcgaggggcagaagaccgctgccttcgagatcatggatgcgctcggc
accgcccccgatatccacgcgctgccggtcggcaacgccgggaacatcaccgcgtactgg
cgcggctacaacgagtactaccgtgacggcctgtcggaccgcctgcccaagatgctgggt
gctcaggccgccggcgccgcaccgctggtcaacggggcgcctgtcgccaatccggagacc
atcgccaccgccatccggatcggatctcccgcttcgtggtcgggcgcggttgccgcgcaa
caggaatcggacggcaagttcctggccgtcaccgatgaggagattctcaacgcctaccgg
ctggtcgcatccagcgagggcgtgttcgtggagcccgcgtcggcagccagcatcgcgggc
ctgctgaaatcggtcgccgacggctgggttgccaagggttccaccgtggtctgcaccgtg
acgggcaacggcctgaaggatcccgataatgcgctgagcggaatgcccgaggtgactccc
atcccggtccaggcgagtgccgtcgccgaggcgctggaactggcgtga

DBGET integrated database retrieval system