KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0797Help
Entry
MYCMA_0797        CDS       T02177                                 

Definition
amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MYCMA_0797
Enzymes [BR:mmv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MYCMA_0797
    3.5.1.-  
     MYCMA_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3313540..3314094
Genome map
AA seq 184 aa AA seqDB search
MGRALIVVDVQNDFCEGGSLSVPGGAALARTLNHLTRSGAYDAVVATRDFHVDPGGHFSE
NPDFETSWPPHCRAGTPGADFHPDLDMGPVDEVFSKGAYGAAYSGFEGVATDGTALAAWL
QSRELNDADVVGIATDYCVAATAHDAVHGGLHTRVLTAYSVGISEESVNRALDELQRAGV
EVIR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggcagggcgcttatcgtcgtcgacgtgcagaacgacttctgcgagggaggctcgctg
tcggtgcccggcggcgccgccctggcccggacactgaatcacctcacccgctccggcgcc
tatgacgcggtggtggcgacccgggactttcacgtcgaccccggcggccatttttcggag
aatccggatttcgagacgagctggccaccacattgccgggccggcacacccggcgcggac
tttcatcccgatctggatatgggccccgtcgacgaggtgttttccaaaggtgcgtacggc
gcggcatattcgggattcgagggcgtcgccaccgacggcaccgcactggcagcctggctg
cagagccgggaactgaatgacgccgacgtggtgggtatcgccaccgactactgcgttgcc
gcgaccgcccacgacgcggtgcacggggggctgcatactcgcgtgcttaccgcctattcc
gttggcatctcggaggaatccgtgaaccgcgccctggacgagctccagcgcgccggcgtc
gaggtgatccgctga

DBGET integrated database retrieval system