KEGG   Mycobacterium massiliense: MYCMA_0885Help
Entry
MYCMA_0885        CDS       T02177                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mmv  Mycobacterium massiliense
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmv01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mmv00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1644287..1645393
Genome map
AA seq 368 aa AA seqDB search
MNPGAQAREAIRSARTVVVKVGTAALTDETGTFSADRMEYLVEVIEGRMKAGSDVVIVSS
GAIAAGMVPLGLTKRPTDLATKQAAASAGQVALIGAWSAAFARYERTVGQVLVTAHDISM
RVHHTNAQRTLDRLTALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSD
IDGLYDSDPRKGNARFISEVSGPEDLADVIAGPGGSRGTGGMASKLSSALLASDAGVPVL
LASATEAAAALGDGSCGTVFAARPQRMSARKFWVRYAAEATGSLTLDAGAVRAVVASRRS
LLPAGITGVSGRFHGGDVVELRDADGTMVGRGVVAYDVAELATMLGRSTNELPEDLRRPA
VHADDLVT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccaggtgcgcaggcgcgtgaggccattcgctcggcgcgcaccgtcgtggtgaag
gtcggcaccgccgcactcaccgatgagacggggaccttcagtgccgaccgcatggaatac
ctcgtcgaggtcatcgaaggccggatgaaggctggatccgatgtggtgatcgtgtcctcc
ggggcgatcgcggcgggcatggttccgctcggattgaccaaacgcccaacggatctggcg
accaagcaggcggcggccagtgcgggtcaagtggcccttatcggcgcctggagtgcggcc
ttcgcgcgttatgagcgcaccgtgggccaggtgctggtgaccgcccacgacatctcgatg
cgcgtgcaccacaccaacgcgcagcgcaccctcgacagactcaccgcattgcacgcggtt
gccatcgtgaacgagaacgacaccgtggccaccaacgagattcgtttcggagacaatgac
cgcctctcggcgctcgtcgcgcatttggtgggtgccgacgcgctggtgttgctctccgac
atcgatgggctctacgattcagacccccgaaaggggaacgcgcgcttcatttctgaggtg
agcggacccgaggacctggccgacgtgatcgccggccccggcggctcgcgtggtactgga
ggcatggcctccaagctctcctcggcgctgctggcttccgacgccggtgtgccggtgctc
ttggcctcggcgacagaggcggcggcggcactgggagacggctcctgcggaactgttttc
gcggcgcggccgcaacgcatgtccgcccgcaagttctgggtacgttacgccgccgaggcc
accggttcactgacgctggacgccggcgcggtacgcgcggtcgtggcgtcccggcgttca
ttgctgcctgccggtatcaccggggtatccggacgcttccacgggggcgatgtcgttgag
ctccgcgacgcggacggcaccatggtcggccggggcgtggtcgcctatgacgtcgctgaa
ttggcgaccatgctgggccgctccaccaacgaactccccgaggatctgcggcgccccgcc
gtgcacgccgacgacctcgtcacctga

DBGET integrated database retrieval system