KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_0885Help
Entry
MYCMA_0885        CDS       T02177                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00330  Arginine and proline metabolism
mmv00332  Carbapenem biosynthesis
mmv01100  Metabolic pathways
mmv01130  Biosynthesis of antibiotics
mmv01230  Biosynthesis of amino acids
Module
mmv_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYCMA_0885
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MYCMA_0885
Enzymes [BR:mmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MYCMA_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFN63036
Position
complement(3160286..3161392)
Genome map
AA seq 368 aa AA seqDB search
MNPGAQAREAIRSARTVVVKVGTAALTDETGTFSADRMEYLVEVIEGRMKAGSDVVIVSS
GAIAAGMVPLGLTKRPTDLATKQAAASAGQVALIGAWSAAFARYERTVGQVLVTAHDISM
RVHHTNAQRTLDRLTALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSD
IDGLYDSDPRKGNARFISEVSGPEDLADVIAGPGGSRGTGGMASKLSSALLASDAGVPVL
LASATEAAAALGDGSCGTVFAARPQRMSARKFWVRYAAEATGSLTLDAGAVRAVVASRRS
LLPAGITGVSGRFHGGDVVELRDADGTMVGRGVVAYDVAELATMLGRSTNELPEDLRRPA
VHADDLVT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccaggtgcgcaggcgcgtgaggccattcgctcggcgcgcaccgtcgtggtgaag
gtcggcaccgccgcactcaccgatgagacggggaccttcagtgccgaccgcatggaatac
ctcgtcgaggtcatcgaaggccggatgaaggctggatccgatgtggtgatcgtgtcctcc
ggggcgatcgcggcgggcatggttccgctcggattgaccaaacgcccaacggatctggcg
accaagcaggcggcggccagtgcgggtcaagtggcccttatcggcgcctggagtgcggcc
ttcgcgcgttatgagcgcaccgtgggccaggtgctggtgaccgcccacgacatctcgatg
cgcgtgcaccacaccaacgcgcagcgcaccctcgacagactcaccgcattgcacgcggtt
gccatcgtgaacgagaacgacaccgtggccaccaacgagattcgtttcggagacaatgac
cgcctctcggcgctcgtcgcgcatttggtgggtgccgacgcgctggtgttgctctccgac
atcgatgggctctacgattcagacccccgaaaggggaacgcgcgcttcatttctgaggtg
agcggacccgaggacctggccgacgtgatcgccggccccggcggctcgcgtggtactgga
ggcatggcctccaagctctcctcggcgctgctggcttccgacgccggtgtgccggtgctc
ttggcctcggcgacagaggcggcggcggcactgggagacggctcctgcggaactgttttc
gcggcgcggccgcaacgcatgtccgcccgcaagttctgggtacgttacgccgccgaggcc
accggttcactgacgctggacgccggcgcggtacgcgcggtcgtggcgtcccggcgttca
ttgctgcctgccggtatcaccggggtatccggacgcttccacgggggcgatgtcgttgag
ctccgcgacgcggacggcaccatggtcggccggggcgtggtcgcctatgacgtcgctgaa
ttggcgaccatgctgggccgctccaccaacgaactccccgaggatctgcggcgccccgcc
gtgcacgccgacgacctcgtcacctga

DBGET integrated database retrieval system