KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0885Help
Entry
MYCMA_0885        CDS       T02177                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCMA_0885
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYCMA_0885
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MYCMA_0885
Enzymes [BR:mmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MYCMA_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3160286..3161392)
Genome map
AA seq 368 aa AA seqDB search
MNPGAQAREAIRSARTVVVKVGTAALTDETGTFSADRMEYLVEVIEGRMKAGSDVVIVSS
GAIAAGMVPLGLTKRPTDLATKQAAASAGQVALIGAWSAAFARYERTVGQVLVTAHDISM
RVHHTNAQRTLDRLTALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSD
IDGLYDSDPRKGNARFISEVSGPEDLADVIAGPGGSRGTGGMASKLSSALLASDAGVPVL
LASATEAAAALGDGSCGTVFAARPQRMSARKFWVRYAAEATGSLTLDAGAVRAVVASRRS
LLPAGITGVSGRFHGGDVVELRDADGTMVGRGVVAYDVAELATMLGRSTNELPEDLRRPA
VHADDLVT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccaggtgcgcaggcgcgtgaggccattcgctcggcgcgcaccgtcgtggtgaag
gtcggcaccgccgcactcaccgatgagacggggaccttcagtgccgaccgcatggaatac
ctcgtcgaggtcatcgaaggccggatgaaggctggatccgatgtggtgatcgtgtcctcc
ggggcgatcgcggcgggcatggttccgctcggattgaccaaacgcccaacggatctggcg
accaagcaggcggcggccagtgcgggtcaagtggcccttatcggcgcctggagtgcggcc
ttcgcgcgttatgagcgcaccgtgggccaggtgctggtgaccgcccacgacatctcgatg
cgcgtgcaccacaccaacgcgcagcgcaccctcgacagactcaccgcattgcacgcggtt
gccatcgtgaacgagaacgacaccgtggccaccaacgagattcgtttcggagacaatgac
cgcctctcggcgctcgtcgcgcatttggtgggtgccgacgcgctggtgttgctctccgac
atcgatgggctctacgattcagacccccgaaaggggaacgcgcgcttcatttctgaggtg
agcggacccgaggacctggccgacgtgatcgccggccccggcggctcgcgtggtactgga
ggcatggcctccaagctctcctcggcgctgctggcttccgacgccggtgtgccggtgctc
ttggcctcggcgacagaggcggcggcggcactgggagacggctcctgcggaactgttttc
gcggcgcggccgcaacgcatgtccgcccgcaagttctgggtacgttacgccgccgaggcc
accggttcactgacgctggacgccggcgcggtacgcgcggtcgtggcgtcccggcgttca
ttgctgcctgccggtatcaccggggtatccggacgcttccacgggggcgatgtcgttgag
ctccgcgacgcggacggcaccatggtcggccggggcgtggtcgcctatgacgtcgctgaa
ttggcgaccatgctgggccgctccaccaacgaactccccgaggatctgcggcgccccgcc
gtgcacgccgacgacctcgtcacctga

DBGET integrated database retrieval system