KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0886Help
Entry
MYCMA_0886        CDS       T02177                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MYCMA_0886
Enzymes [BR:mmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MYCMA_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3157239..3158105
Genome map
AA seq 288 aa AA seqDB search
MTELATVCVLGSVNMDLTLRVEELPAPGATVLATSAMPAPGGKGANQAVAAARAGATVQF
IGAVGSDGAAPMLRSHLSDNNVGLDGLVEVDGPSGMATITVEDSGENCIVVAPGANTAFT
LDEKVHKDIICSHDVLLCQLEIPVRVALTAARWAAEAGKQFVLNASPVPERSPDLAELAF
RASVVVVNETEAQSWLYPSRHLVTTLGDEGSRYRSPQGQITVPSYPVRPLDTTGAGDVFA
GVLAAWWPQGAETALRRANVAGALATLRAGAGNCAPTGARIELSLKGS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagttagccacggtatgcgtcctcggtagcgtcaacatggatctgacgttgcgg
gtagaggagcttcccgcccctggagcaacggtgctggcgacatcggccatgcccgctccg
ggaggcaagggcgccaatcaggccgtggcagccgcacgtgcgggcgccacggtgcagttc
atcggcgcggtgggctccgatggcgcggcgccgatgctgcgatctcacctgtcggacaac
aatgttggtctggacggcctggtcgaggtcgacggccccagcggaatggccaccatcacc
gtggaggactccggtgagaactgcattgtggtggcgcccggggccaacaccgccttcacc
ctggacgagaaggtgcacaaggacatcatctgctcgcacgacgtgctgctgtgccagctg
gaaattccggtgcgggtggcgctgaccgcggcccgctgggccgccgaggccggaaagcaa
ttcgtgctcaacgcttctcccgtacccgagcgctcccccgacctagcggagctggccttt
cgggcgagcgtggtcgtcgtcaacgaaaccgaggcgcagtcctggctgtacccgtcgcgc
catctggtgaccaccctcggcgacgagggttctcggtaccgcagtccgcaagggcagatc
acggtgccgtcctatccggtgcggccgctggacaccaccggcgccggtgacgttttcgcc
ggggtgctggccgcctggtggccccagggtgccgagactgccctccggcgtgcgaatgtg
gccggggcgctggccacgctgcgcgcaggagccggaaactgcgcgccgaccggggccagg
atcgagctgtcgctcaaggggtcctga

DBGET integrated database retrieval system