KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1012Help
Entry
MYCMA_1012        CDS       T02177                                 

Gene name
dlaT
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCMA_1012 (dlaT)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCMA_1012 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    MYCMA_1012 (dlaT)
Enzymes [BR:mmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MYCMA_1012 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1944054..1945370)
Genome map
AA seq 438 aa AA seqDB search
MPELGESVTEGTVTRWLKKVGDEVGVDEPLVEVSTDKVDTEIPSPVAGVLLSISANEDDT
VAVGGELAVVGAABAAPXAPAAPAAPAPEPAAAPAAAAAPPAPPAPAPAAPAAPAPAPAA
PAANGAAGDNPYVTPLVRKLAAENNVDLSALSGSGVGGRIRKQDVLAAAEAAXAPAAAPA
PAAPAASAPAAVAPSLAHLRGTTQKANRIRQITAKKTRESLQETAQLTQTHEVDVTKIAA
LRARAKAAFAEREGVNLTFLPFFAKAAVEALKTHPNVNASYNEESKEITYFDAEHLGIAV
DTDQGLLSPVIHNAGDLSLAGLARAIADIAARARSGNLKPDELAGGTFTITNIGSQGALF
DTPILVPPQAAMLGTGAIVKRPRVIRDDAGNESIGIRSVCYLPLTYDHRLIDGADAGRFL
TTIKHRLEEGAFEADLGL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctcggtgagtccgtcaccgarggcaccgtgacccgctggctcaagaaggtc
ggcgacgaggtcggcgtggacgaaccgctcgtcgaggtrtccaccgacaaggtcgacacc
gagattccgtcgccggtggccggtgtgctgctcagcatctcggccaacgaggatgacacc
gtggccgtgggcggcgagcttgccgtcgtcggmgccgccracgccgcgccysckgcyccc
gcagctcctgcggcgcccgctcccgagcctgccgcagctcctgccgcggcagckgcwcck
cckgctcccccagccccmgcaccagccgcacckgcggccccggctcccgcgccggcggct
ccggctgcgaacggcgccgccggcgacaacccgtacgtgaccccgctcgtgcgcaagctc
gccgccgaaaacaacgtggacctttccgcgctgtccggcagcggtgtgggcggacgcatc
cgcaagcaggatgtgctggccgccgcggaggccgccmaggctccggccgccgctcccgct
cccgcggctcccgccgcgtccgcgcctgcggccgtggcaccgtccctggcgcacctgcgc
ggaaccacgcagaaggccaaccggattcgtcagatcactgccaagaagacgcgcgagtca
ctgcaggagaccgcccagctgacccagacccacgaggtcgacgtcaccaagatcgcggcc
ctgcgcgcccgggccaaggcggcgttcgccgagcgcgagggtgtgaacctgacgttcctg
ccgttcttcgccaaggccgcggtggaggcactcaagacgcacccgaatgtcaacgcgagc
tacaacgaggaatccaaggagatcacctacttcgacgccgagcacctgggcatcgcggtc
gacaccgaccaaggcctgctctccccggtgatccacaacgccggtgacctgtcgctggcc
ggtctggcgcgcgcgatcgccgatatcgcggcacgggcccgttccgggaacctcaagccc
gacgagctggccggtggcaccttcaccatcaccaacatcggcagccagggcgccttgttc
gacacaccgatcctggtgccgccgcaggccgccatgctcggcaccggcgcgatcgtgaag
cgtcccagggttattcgtgatgacgctggtaacgagtcgatcggtatccggtcggtgtgc
tacctgccgctgacctacgatcaccgcctgatcgacggagccgacgcggggcggttcctg
acgaccatcaaacaccgtctggaagagggggctttcgaggcggacctgggtctgtag

DBGET integrated database retrieval system