KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1025Help
Entry
MYCMA_1025        CDS       T02177                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCMA_1025
Enzymes [BR:mmv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MYCMA_1025
Peptidases [BR:mmv01002]
 Cysteine Peptidases
  Family C44
   MYCMA_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2911642..2913582
Genome map
AA seq 646 aa AA seqDB search
MCGLVAWLGPPGSSLESHSPAVDAAMVHMRHRGPDEPGIWHEGNVLFGFNRLSIIDIAHS
HQPLRWGPPDAPGRYVLVFNGEIYNYLELRETLAAEHGAVFATEGDGEAILAAYHFWGPD
ALHRLRGMFAFAIWDTAERELFCARDPFGIKPLFMATGPGGTALGSEKKCLLDLVEQLGI
GTELDLRALQHYTTLQYVPEPESLHTEIRRLESGSYARIAPGQEPRITRYFPARFEVAPF
TRATRQSRYDEITEVLSDSVAKHMRADVTVGSFLSGGIDSTAIAALAIRHNPKLITFTTG
FERQGYSEVDVAVESAQAIGARHIVKVVSQEEFVSALPEIVWYLDDPVADPSLVPLFFVA
REARKHVKVVLSGEGADELFGGYTIYREPLSLKPFEYLPGALRRAAARLSAAIPDGVRGK
SLLHRGSMTLEQRYYGNARSFDDEQLRAVLPHYRPEWGHQDVTASLYERCAGWDPVARMQ
YLDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFKVASRLPYREKINGQPTKKTTKY
ALRKALEPIVPAHVLHRTKLGFPVPIRHWFVDGLLHDWAREMLSTTQAGHLIDVPAVGRM
LTEHAAGVSDHSRRLWTVLIFMLWHAIFVEQSVRPQIQEPHYPVQL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactggtggcgtggctgggcccgcccgggtcttccctcgaatcccatagcccg
gcggtggatgcggcgatggtgcacatgcgccaccgcggccccgatgaacctggcatttgg
cacgagggaaacgtgctcttcggcttcaatcggctgtcgatcatcgacatcgcgcattca
catcagccgttgcgctggggtccgccggacgcgccgggccggtatgtgttggtcttcaac
ggcgagatctacaactacctggagctcagggagacgctggcggccgaacatggcgccgta
ttcgccaccgagggcgacggcgaggcgatcctggcggcgtaccacttctggggaccggac
gcgctacaccggctacgcggcatgttcgcgttcgcgatctgggacaccgcggaacgcgag
ttgttctgcgcccgcgatcctttcggcatcaagccgctcttcatggcgacgggcccgggc
ggcaccgcactcggcagcgagaagaaatgcctgctggatctcgtcgaacagctgggcatc
gggaccgagttggacctgcgcgcgctgcagcattacacgacgctgcaatacgttccggag
cccgagagcctgcacaccgagatccgccgcctggagtccggttcgtacgcccgcatcgcc
cccggacaggagccgcgcatcacgcgctacttcccggcccgattcgaggtggccccgttc
acgcgtgccacgcgccagtcccggtacgacgagatcaccgaggtgctctccgattcggtg
gccaagcatatgcgcgcggacgtcacggtgggctcgttcctgtcgggcggcatcgactcg
acggccatcgccgcgctggcgatccggcataaccccaagctcattactttcacaacaggc
tttgagcggcaaggctattccgaggtcgatgtggcggtggagtcggcgcaggcaatcggc
gcccgccatatcgtcaaagtggtcagccaggaggagttcgtctccgcactgccggaaatc
gtgtggtacctggacgatccggtggcagatccgtccttggtgccgttgtttttcgtggca
cgggaggctcgcaaacacgtcaaggtggtgctctccggcgagggcgccgacgagctgttc
ggcggatacacgatctaccgggagcccttgtcgctcaagcctttcgaatacctgccgggc
gcactacggcgcgctgcggcacgattgtcggccgcaatcccggacggagtccgcggtaag
agcctgctacaccgcggatcgatgaccctggagcagcgctactacgggaacgcccgcagc
ttcgacgatgagcagttgcgtgcggtgctcccccactaccgcccggaatggggccaccag
gacgtgacggcgtccctgtacgagcggtgtgcgggttgggatcctgtggcccgcatgcaa
tacctggatctgttcacctggctgcgcggcgacatcttggtcaaggccgacaagatgacc
atggccaactcgctggaactgcgggtgccgttcctcgaccccgaggtgttcaaggtggcc
tcgcggctgccctatcgggagaagatcaacgggcaaccgaccaagaagacgaccaagtac
gccttgcgcaaggcactggaacccattgtgccggcgcatgttctgcaccggaccaagctc
ggcttcccggtgcccatccggcattggtttgtcgacgggctactgcacgactgggcccgc
gagatgctctccaccacacaggcagggcacctgatcgacgtgcccgccgtcggccgcatg
ctcaccgagcacgccgccggcgtcagcgatcacagccgcaggctgtggacggtgctgatc
ttcatgctgtggcacgcgatcttcgtcgagcagtcagtgcggccccagatccaggagccg
cactacccggtgcagctctaa

DBGET integrated database retrieval system