KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1308Help
Entry
MYCMA_1308        CDS       T02177                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCMA_1308
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYCMA_1308
   00630 Glyoxylate and dicarboxylate metabolism
    MYCMA_1308
Enzymes [BR:mmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MYCMA_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2498182..2500389
Genome map
AA seq 735 aa AA seqDB search
MSDRVDVGNLRVARVLYDFITNEALPGTGVDADAFWAGVDKVVTDLAPRNRELLERRDDL
QTQIDRWHRQRAIEPLDGAAYQDFLTEIGYLVPEPEDFTITTANVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVIPEADGAEKASADTGGYNKVRGDKVIAYAREVL
DGAVPLASGSWKDAVGLKIDDGQLLVELGDEFSTGLQNPDQFVGYTGKLGKPQWSVLLIN
HGLHIEVLIDPDSPIGSTDKAGIKDVVLESAITTIMDFEDSVAAVDAEDKVLGYRNWLGL
NKGDLSEEVSKGGKTFTRVLNEDRVFTTPDGKGELTLPGRSLLFVRNVGHLMTNDAIVDA
AGNEMPEGIQDALFTSLIAIHGLRSGKKNGPLKNSRTGSIYIVKPKMHGPEEVAFTAELF
GRVEEVLGLPHATLKVGIMDEERRTTVNLKAAIKAASDRVVFINTGFLDRTGDEIHTSME
AGPMCRKAVMKSQPWILAYEDHNVDTGLGAGLAGKAQIGKGMWAMPDLMADMVAQKISQP
RAGATTAWVPSPTAATLHALHYHQVDVKAVDQELAGKHRAKLESLLTIPLAESRHDWTAE
DIREEIDNNCQSILGYVVRWIDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHDV
ITEDEVVEGLKRMAPVVDRQNAGDKEYRPMAPDFDSNIAFQAAKELILEGKDQPNGYTEP
ILHRRRREYKAAAAK
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgcgtcgatgtgggcaacctacgcgtggcgcgggtgctgtatgacttcatc
accaacgaggcccttccgggcaccggtgtggatgccgacgctttctgggccggagtcgac
aaagtagtcaccgatttggctccgcggaaccgcgagctgctcgagcgccgggacgatctg
caaactcagatcgatcgctggcaccggcagcgcgccatcgaaccactcgatggcgccgcg
taccaggacttcctgaccgagatcggatacctggttcccgagcccgaagatttcaccatc
accaccgccaatgtggacgacgagatcaccaccacggccggtccgcagctggtggtgccg
attctgaacgcgcgcttcgcgctcaacgccgccaacgcgcgctggggctccctctacgat
gcgctgtacggcaccgatgtcatcccggaagccgatggcgccgaaaaggcgtccgcggac
actggtgggtacaacaaggtccgcggtgacaaggtcatcgcctacgcccgcgaggtgctc
gacggtgccgtgccgctagcatccggctcgtggaaggacgccgtcggcctgaagatcgac
gacggacagctgctcgtcgagctgggcgacgagttctcgacgggtctgcagaaccccgat
caattcgtgggctacaccggcaagctcggtaagccccagtggtcggtgctgctgatcaac
cacggcctgcatatcgaggtgctgatcgaccccgactcccccatcggttccaccgacaag
gccggcatcaaggatgtggtgctggagtcggcgatcaccacgatcatggacttcgaggac
tcggtcgcggccgtggacgccgaggacaaggtgctcgggtaccgaaactggttgggcctc
aacaagggcgacctgtccgaagaggtgtccaagggcggcaagacgttcacccgcgtgctc
aacgaggaccgtgtcttcaccacccccgacggcaagggcgagctgacgctgcccggtcgc
agtctgctgttcgtccgcaacgtcggtcatctgatgaccaatgacgccatcgtggacgcc
gcgggcaacgagatgcccgagggcatccaggacgcgctgttcaccagtctgatcgccatc
cacggcctgcgctcgggcaagaagaacggcccgctcaagaacagccggaccggctcgatc
tacatcgtgaagcccaagatgcacggacctgaggaagtggccttcaccgccgagctgttc
ggccgcgtggaagaggtgctcggattgccgcacgccaccctcaaggtcggcatcatggac
gaggagcgccgcaccaccgtcaatctgaaggccgccatcaaggctgcctcggatcgggtg
gtcttcatcaacaccggattcctggaccgcactggcgacgagatccacacctccatggaa
gccggtccgatgtgtcgtaaggccgtcatgaagtcgcaaccgtggatcctggcgtacgag
gaccacaacgtggacacggggctgggcgccggtttggccggcaaggcgcagatcggcaag
ggcatgtgggccatgccggacctgatggcggacatggtggcgcagaagatctcgcagccg
cgcgccggtgccaccacggcgtgggtgccgtcccccaccgcggcgactctgcacgcgctg
cactaccaccaggtcgacgtcaaagcggtggaccaggagctcgccggtaagcaccgcgcc
aagctggagtctttgctcaccatcccgctggccgagtcgcgccatgactggaccgccgaa
gacatccgcgaggaaatcgacaacaactgccagtcgatcctgggctacgtggtccgctgg
atcgaccagggcgtcggctgctccaaggtgccggatatccatgacgtggcactcatggaa
gaccgcgccaccctgcgcatctccagccagctactggccaactggttgcgccacgatgtg
atcaccgaggacgaggtggtcgaggggctcaagcggatggctccggttgtcgaccggcag
aacgcgggcgacaaggagtaccgcccgatggctccggacttcgacagcaacattgccttc
caggccgccaaggaactcatcctggagggcaaggaccagccgaacggctacaccgagccg
atcttgcaccggcggcgccgtgagtacaaggccgccgctgccaagtag

DBGET integrated database retrieval system