KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1432Help
Entry
MYCMA_1432        CDS       T02177                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCMA_1432 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCMA_1432 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYCMA_1432 (trpA)
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MYCMA_1432 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2684862..2685650)
Genome map
AA seq 262 aa AA seqDB search
MTQPGRLTEVFDKCRAEERAALIGYLPNGYPDLDTSIELMTTLVRGGCDIIEVGIAYSDP
MMDGPMIAAAAETALANGVRVADVFTTVRAITDAGGHAVVMSYWNPVLRYGVDAFARELA
AAGGLGIITPDLIPDEADDWIAASDAHDLDRIFLVAPSSTPERLARTIGACRGFVYAAST
MGVTGARDAVSNAAPALVSRVREVSDIPVGVGLGVRSGAQAAEIAAYADGVIVGSALVAA
APQGPAAVRSLAEELATGVRRA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccggccgtctgaccgaggtgttcgacaagtgccgcgccgaagaacgcgcc
gcgctgatcggatacctgcccaacggttacccggacctggacacctcgatcgaactgatg
accaccctggtgcggggaggttgcgacatcatcgaagtggggatcgcgtactcggatccg
atgatggatggtccgatgatcgccgccgcagcggaaactgcgctcgccaacggggttcgg
gtggcggacgtcttcaccaccgtccgcgccatcaccgatgccggcggtcacgcggtcgtc
atgtcctactggaacccggtgctgcgttacggcgtcgacgcgttcgcacgtgagctcgcc
gcggcgggtggcctcggaatcatcacaccggatctgatcccggacgaggccgatgactgg
atcgccgcctcggacgctcatgatctggaccggatctttctcgtcgccccgtcgtccacg
cccgaaaggctggcgaggaccatcggcgcctgccggggatttgtctacgcggcatcgacc
atgggtgtcaccggtgcgcgtgacgcggtatccaatgccgcaccggccctggtgagcagg
gtccgtgaggtctccgatatcccggtgggggtcggactcggcgtgcggtcgggcgcgcag
gcggccgagatcgcggcctacgccgacggcgtcatcgtcgggtcggcgttggtggcggcg
gccccgcagggtcccgccgccgtgcgcagcctggccgaggaactggccaccggagtccga
agggcatga

DBGET integrated database retrieval system