KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1434Help
Entry
MYCMA_1434        CDS       T02177                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCMA_1434
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYCMA_1434
Enzymes [BR:mmv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MYCMA_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2265920..2266738
Genome map
AA seq 272 aa AA seqDB search
MSSGTVLDSILDGVRADVAAREAVVDLATVKAAAKAAPKPLDVMAALREPGIAVIAEVKR
ASPSRGALAEISDPAELAKAYEDGGARIISVLTEGRRFNGSLDDLDSVRAAVSVPVLRKD
FVISPYQIHEARAHGADLILLIVAALEQTALVSLLDRTESLGMTALVEVHTEEEADRALS
AGASVIGVNARDLKTLEIDRDCFSRIAPGLPSGVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRGAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgggaaccgtactcgattcgatcctcgatggcgtgcgcgctgatgtcgcggct
cgcgaagccgttgtcgatctcgccaccgtgaaggccgccgccaaggccgcgcccaagccg
ctcgatgtgatggccgctctgcgcgagcccggtatcgccgtcatcgccgaggtcaagcgg
gccagcccgtcgcgcggcgcgctggcggagatcagcgatcccgccgagctcgccaaggcc
tatgaagacgggggagcccgcatcatcagcgtgctcaccgaggggcggcggttcaacgga
agtctcgacgacctggattcggtgcgtgccgctgtatcggttcccgtgctgcgcaaggac
tttgtgatcagcccctatcagatccacgaggcgcgtgcgcacggcgccgacctgatcttg
ctgatcgtggcggcgctcgaacagacggcattggtctcgctgcttgaccgcaccgagtcg
ctcggcatgaccgccttggtcgaggtgcacaccgaagaagaggccgatagggctctgtcc
gccggagcctcggtcatcggcgtgaacgcgcgcgatctgaaaacccttgaaatcgatcgg
gattgcttctcgcgcatcgcgccgggactgcccagcggtgtcatccgcatcgccgagtcg
ggggtccggggtaccgccgatctactcgcctacgccggcgccggcgcagatgccgtactg
gtgggtgaggggttggtgaccagcggagatccgcgaggggcggtcgccgatctggtgacc
gcgggcacgcatccgtcctgccccaaaccggctcgctag

DBGET integrated database retrieval system