KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_1452Help
Entry
MYCMA_1452        CDS       T02177                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00340  Histidine metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01230  Biosynthesis of amino acids
Module
mmv_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MYCMA_1452
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MYCMA_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFN63593
Position
2251979..2253328
Genome map
AA seq 449 aa AA seqDB search
MAYVNDAAPVLLRRIDMRGASLSPSHLRAALPRGGTDVDAVLPRVRPVVEAVRDRGAEAA
LDFCAEFDGVRPGTVRVPVAELDRALADLDPAVRDALEVAILRARAVHADQRRQDTVTAV
ADGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGVGSLVIASPPQAQFGGLP
HPTILAAARLLGVEEVWAVGGAQGVALLAHGGTDTDGAELAPVDMITGPGNIYVTAAKRL
CRSLVGIDAEAGPTEIAILADETADPVHVAADLISQAEHDVLAASVLVTDSAALADAVVK
ETSAQLATTVHAERVSAALTGTQSGIVLVDDIDAGIKVVNAYAAEHLEIHTVEPVPVAAR
VRNAGAIFLGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHIVDYTEAALK
EVAGHVIALANAENLPAHGEAVRRRFERS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgtgaatgacgccgcgcccgtcctgcttcgccgtatcgacatgcgtggtgcg
agcctgtcgccgtcgcacctgcgcgctgccctgcccaggggcggcacggacgttgacgcc
gtgttaccgcgggtgcggcccgtcgtagaggcagttcgtgaccgtggcgcagaggccgca
ctggatttctgtgccgagttcgatggtgtccgtcccggcaccgtccgggttcccgtggct
gagctggaccgtgcccttgccgatctcgaccccgccgtgcgcgacgcgctcgaggtggcg
attctgcgcgcccgggccgtacacgccgatcagcgccgccaggacaccgtgaccgcggtc
gccgacggcgcgacggtgaccgagcggtgggtacctgtcgagcgagtgggcctttacgtg
cccgggggcaacgccgtgtacccatcgagcgtcgtgatgaacgttgtgcccgcgcagacg
gcgggagtgggatcgctcgtcatagcgtcgccgccccaggcgcagttcggcggtctgccg
catccgaccattttggcggcggcgcggttgctcggtgtcgaagaggtctgggcggtcggc
ggcgcacagggcgtggcgctgctggcgcacggcggcaccgataccgatggggcagagctc
gcaccggtcgacatgatcaccgggcccggaaacatctatgtgaccgctgccaagcggttg
tgccgatcgctggtgggcatcgacgcggaggccggccccaccgagatcgcgattctcgcc
gacgagaccgccgatccggtgcatgtggccgcggacctgatcagccaggccgaacacgat
gtgttggcggccagcgtcttggtcaccgacagtgcggcacttgccgacgcggtggtcaag
gagacctccgcgcaattggcgactacagtgcacgccgaacgcgtcagcgctgcgctgacc
ggcacgcaatccgggatcgtgcttgtcgacgacatcgacgcgggcatcaaggtggtgaac
gcctacgcggccgagcacctggagattcacacggtcgaaccggtaccggtggccgcgcgg
gtgcgcaatgccggtgcgattttcctggggccgtggtcgccggtgagcctcggcgactat
tgcgccggctccaaccacgtgctacccaccgccggatgcgcgcggcactccagtgggttg
tccgtgcagaccttcctgcgcggtatccacatcgtggactacaccgaagcggcactcaaa
gaggtcgccgggcatgtgatcgcactggccaacgccgagaatctgcccgcgcacggtgag
gccgtccgacgcaggttcgagcgatcatga

DBGET integrated database retrieval system