KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1496Help
Entry
MYCMA_1496        CDS       T02177                                 

Gene name
echA12
Definition
enoyl-CoA hydratase echA12 (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYCMA_1496 (echA12)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCMA_1496 (echA12)
   00650 Butanoate metabolism
    MYCMA_1496 (echA12)
  Lipid metabolism
   00071 Fatty acid degradation
    MYCMA_1496 (echA12)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCMA_1496 (echA12)
   00310 Lysine degradation
    MYCMA_1496 (echA12)
   00360 Phenylalanine metabolism
    MYCMA_1496 (echA12)
   00380 Tryptophan metabolism
    MYCMA_1496 (echA12)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCMA_1496 (echA12)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYCMA_1496 (echA12)
   00281 Geraniol degradation
    MYCMA_1496 (echA12)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYCMA_1496 (echA12)
   00627 Aminobenzoate degradation
    MYCMA_1496 (echA12)
   00930 Caprolactam degradation
    MYCMA_1496 (echA12)
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYCMA_1496 (echA12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2787221..2788030)
Genome map
AA seq 269 aa AA seqDB search
MSFVLVDRPRPEIALVTLNRPERMNAMAFDVMLPFKQMLVDISHDNDVRAVVITGAGKGF
CSGADQKSAGPIPHIGGLTQPTIALRSMELLDEVILTLRRMHQPVIAAINGAAIGGGLCL
ALACDVRVASQDAYFRAAGINNGLTASELGLSYLLPRAIGTSRASDIMLTGRDVDADEAE
RIGLVSRKVASESLLEECYAIGERIAGFSRPGIELTKRTIWSGLDAASLESHMHQEGLGQ
LYVRLLTDNFEEATAARKEKRPAEFRDKR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgtcctggtggaccgtccgcgtccggaaattgcgctggtcacactgaaccgg
cccgagcggatgaatgccatggcgttcgacgtgatgctgcctttcaagcagatgctcgtc
gatatcagccacgacaatgacgtgcgcgccgtcgtcatcacgggcgccggtaagggcttt
tgttcgggcgccgaccagaagtcggccggccccattccgcatatcggcgggctgacccag
cccaccatcgcgttgcgttccatggaactgctcgacgaggtgatcctgacgctgcgccgc
atgcatcagccggtgatcgcggccatcaacggagcggccatcggcggcggcctgtgcctg
gcgctggcgtgcgacgtccgggtggcctcgcaggacgcgtacttccgggcggccggtatc
aacaacgggttgaccgccagcgaactgggcctgagctatctgctgccccgcgccatcggc
acctcgcgcgcctctgacatcatgttgaccggccgcgacgtcgacgccgacgaggccgaa
cgcatcggattggtatcccggaaggtggcgtccgagtcgctgctggaagagtgttacgcg
atcggggaacgcatcgccgggttctcccggccgggaatcgagttgaccaagcgcacgatt
tggagtgggctggacgccgctagcctggaaagtcatatgcaccaagagggcctgggccag
ctatatgtccggctgctcaccgacaacttcgaagaagccaccgccgcgcgcaaggagaag
cggccggcggaattcagagacaagcgctga

DBGET integrated database retrieval system