KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1518Help
Entry
MYCMA_1518        CDS       T02177                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCMA_1518
   01230 Biosynthesis of amino acids
    MYCMA_1518
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCMA_1518
   00051 Fructose and mannose metabolism
    MYCMA_1518
   00562 Inositol phosphate metabolism
    MYCMA_1518
Enzymes [BR:mmv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYCMA_1518
Exosome [BR:mmv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYCMA_1518
  Exosomal proteins of bladder cancer cells
   MYCMA_1518
  Exosomal proteins of melanoma cells
   MYCMA_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2134815..2135600
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDIRSVQTLVDGD
KLRLTYGAQDLSVYDSGAYTGEVSGAFLAKLGVTYVVVGHSERRQYHGEDDALVAAKAAA
ALKHGLTPIVCIGEALDIREAGDHVQYNVNSLRGSLAGLSAEQVGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRAELAQIANADVAGSVRVLYGGSANAKNVGEIVAQEDVDGALVGG
ASLDGEQFAQMSAIAAGGPLL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtaagccgttgatcgccggcaactggaagatgaatctcaatcatttcgaggcc
atcgctttggttcagaagatcgcgttctcgttgccggacaagtacttcgacaaggtggac
gtgacggtcattccgccgttcaccgatatccgcagcgtgcagaccctggtggacggtgac
aagttgcgccttacctatggcgcacaggacctgtccgtatatgactcgggcgcgtacacc
ggtgaggtcagcggcgccttcctggccaagctgggtgtcacctatgtcgttgtcggtcac
tccgagcgccgccagtatcacggcgaggatgacgcgctggtcgcggccaaggctgccgcg
gccctcaaacacggcctcacaccgatcgtgtgtatcggtgaggcacttgacatccgggaa
gccggagatcacgtccagtacaacgtgaactccctgcgcgggtcactggccggcctcagc
gccgaacaggtgggcaaggtggtcatcgcctacgagccggtgtgggccatcggcaccggg
cgggtggccagcgccgccgacgcgcaggaagtgtgcgcagcgatccgcgccgagttggcg
cagattgcgaacgccgacgtggcggggtctgtccgggtcctgtacggcggctcggccaac
gccaagaacgtcggtgagatcgttgcgcaggaggatgtcgacggagcgttggtcggtggc
gcctcgctggacggcgaacagttcgcccagatgtcggcgatcgcggcgggcggtccgctg
ctctag

DBGET integrated database retrieval system