KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1518Help
Entry
MYCMA_1518        CDS       T02177                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCMA_1518
   01230 Biosynthesis of amino acids
    MYCMA_1518
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCMA_1518
   00051 Fructose and mannose metabolism
    MYCMA_1518
   00562 Inositol phosphate metabolism
    MYCMA_1518
Enzymes [BR:mmv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYCMA_1518
Exosome [BR:mmv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYCMA_1518
  Exosomal proteins of bladder cancer cells
   MYCMA_1518
  Exosomal proteins of melanoma cells
   MYCMA_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2134815..2135600
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDIRSVQTLVDGD
KLRLTYGAQDLSVYDSGAYTGEVSGAFLAKLGVTYVVVGHSERRQYHGEDDALVAAKAAA
ALKHGLTPIVCIGEALDIREAGDHVQYNVNSLRGSLAGLSAEQVGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRAELAQIANADVAGSVRVLYGGSANAKNVGEIVAQEDVDGALVGG
ASLDGEQFAQMSAIAAGGPLL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtaagccgttgatcgccggcaactggaagatgaatctcaatcatttcgaggcc
atcgctttggttcagaagatcgcgttctcgttgccggacaagtacttcgacaaggtggac
gtgacggtcattccgccgttcaccgatatccgcagcgtgcagaccctggtggacggtgac
aagttgcgccttacctatggcgcacaggacctgtccgtatatgactcgggcgcgtacacc
ggtgaggtcagcggcgccttcctggccaagctgggtgtcacctatgtcgttgtcggtcac
tccgagcgccgccagtatcacggcgaggatgacgcgctggtcgcggccaaggctgccgcg
gccctcaaacacggcctcacaccgatcgtgtgtatcggtgaggcacttgacatccgggaa
gccggagatcacgtccagtacaacgtgaactccctgcgcgggtcactggccggcctcagc
gccgaacaggtgggcaaggtggtcatcgcctacgagccggtgtgggccatcggcaccggg
cgggtggccagcgccgccgacgcgcaggaagtgtgcgcagcgatccgcgccgagttggcg
cagattgcgaacgccgacgtggcggggtctgtccgggtcctgtacggcggctcggccaac
gccaagaacgtcggtgagatcgttgcgcaggaggatgtcgacggagcgttggtcggtggc
gcctcgctggacggcgaacagttcgcccagatgtcggcgatcgcggcgggcggtccgctg
ctctag

DBGET integrated database retrieval system