KEGG   Mycobacterium massiliense: MYCMA_1596Help
Entry
MYCMA_1596        CDS       T02177                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmv  Mycobacterium massiliense
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2939121..2939729)
Genome map
AA seq 202 aa AA seqDB search
MIASVNGEVIDIALDHVVIEAAGVGYRVNATPATLSTLRRGTRIRLITAMIVREDSMTLY
GFTDTDARDLFTTLLGVSGVGPKIAMATLAVYDAPALRQALADGDVAALTRVPGIGKRGA
ERLVLELREKVAAAPGGATELGRGTASLVRSQVVEALIGLGFAAKQAEQATDTVLAQDNP
GDTGADVSAVLRSALALLGKTR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcatcggtcaacggcgaggtcatcgacatcgcgctcgaccatgtggtgatcgag
gcggccggcgtggggtaccgcgtgaacgccacaccggccacgctctccacgctgcggcgc
ggcacccggattcggctgatcacggcgatgatcgtccgcgaagattcgatgacgctctat
ggcttcaccgacaccgatgcccgcgatctgttcacgacgttgcttggtgtctccggggtg
gggcccaaaatcgcgatggccaccctcgcggtctatgacgcaccggccctgcgtcaggcg
ctggccgacggcgatgtcgccgcactcactcgggtaccggggattggtaagcgtggggcc
gagcgcttggtgctggagttgcgggagaaggtggctgccgctccgggcggcgccaccgaa
ctggggcgtggcactgcgtcgctggtgcgctcgcaggtcgtcgaggcactgatcggactt
ggctttgccgcaaaacaagccgagcaagccaccgacaccgttctggcccaagataatccg
ggcgatacgggcgcggacgtttccgcagtgctgcgctcggcactggcgttgctgggtaag
acgcgatga

DBGET integrated database retrieval system