KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1623Help
Entry
MYCMA_1623        CDS       T02177                                 

Gene name
uox
Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MYCMA_1623 (uox)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    MYCMA_1623 (uox)
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     MYCMA_1623 (uox)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2985729..2986787)
Genome map
AA seq 352 aa AA seqDB search
MVHRQRNRGVLSGSDHQLPGRRNRGAPACAAAAESVRLLDLPRQLRKEAPMGIVLAGNQY
GKAENRVVRIYRDTPRHEIKDLNVGSALRGDFAAAYTDGDQRKVLPTDSQKQTIYAYAKE
KGIETIEQYGLELARHFVDDYEPVTGARIEIDEYAWERVTVDGREHDHTWVRKGQEVRTA
EVTVDGVGAQQQTWVIGGLKDLVVLKSTGSEFHDFLEDKYTILQPTTDRVMATSLVAKWR
FVGTDIDWDNTYFGVKSLILERFATVHSLALQQTLYEIGKAILESYPSIAEVRLSAPNKH
HFVYDLSPFGLDNPNEVFHADDRPYGLIQAAVTRDDAPDAGPAWSPHLSWLV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggttcaccgacaacggaatcgaggggttttatccggaagtgatcatcagcttccgggc
cgacggaaccgcggggcacctgcatgtgccgctgctgctgagtccgtacgcctactcgac
ctaccgcggcagctgagaaaggaagcacccatgggaatcgttctcgcaggcaatcaatac
ggcaaggccgagaaccgggtggtccggatctaccgggacaccccacgccacgagatcaag
gatctcaacgtcggcagcgcgttgcgcggggatttcgccgcggcctataccgacggcgac
cagcgcaaggtgctgcccaccgacagccagaagcagaccatctatgcctacgccaaggaa
aaaggtatcgagaccatcgagcagtacgggctcgagctggcgcgccacttcgtggacgac
tatgagccggtgacgggcgctcgtatcgagatcgatgaatatgcctgggaaagagtgacg
gtcgacggacgcgagcacgatcacacctgggtgcgcaaaggtcaggaggtgcgcacggcc
gaggtcaccgtggacggtgtcggggcccagcagcagacctgggtgatcggcgggctcaag
gatctggtcgtgctcaaatcgacgggctcggagttccatgatttcctcgaggacaagtac
acgatcctgcagccgacgacggaccgggtgatggccacctcgctggtggccaagtggcgc
tttgtgggcaccgatatcgattgggataatacatatttcggtgtaaagtcgctcatcctc
gagcggttcgccaccgtgcactcgctggccctgcagcagacgttgtacgagatcggcaag
gcgatcctggagtcttatccgtcaatcgccgaagtgcggctctcggcacccaacaagcac
catttcgtctacgacctatcgcctttcgggctggacaatcccaacgaggtgttccatgcc
gatgaccgtccatatgggttgattcaggccgcggttacccgtgatgacgcccccgatgcg
gggccggcctggtccccgcatctgtcctggttggtttag

DBGET integrated database retrieval system