KEGG   Mycobacterium massiliense: MYCMA_1695Help
Entry
MYCMA_1695        CDS       T02177                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mmv  Mycobacterium massiliense
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmv00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mmv00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3135368..3135859)
Genome map
AA seq 163 aa AA seqDB search
MTGTIGLIWAQTRAGVIGADGAIPWRLPEDQARFKRITMGHTVIMGRKTWESLPGSVRPL
PGRPNIVLTRDALFEPDGALAVGCADAALAASDEAPWVIGGGEIYRLFLPLAQRCEVTVV
EADVPGDALAPELGEGWVVEENDWQTSESGLRYQFLSYRKVDG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaccatcgggctgatctgggcgcaaacccgagccggagtcatcggcgcggac
ggtgccattccttggcggctacccgaagaccaggcacgtttcaagcgaatcaccatgggg
cacacagtgatcatgggtcgcaagacctgggagtcgctgcccggtagtgtccggcctttg
ccgggtcggcccaatatcgtgctgaccagggatgccctgttcgagcctgacggggcattg
gccgtcggctgcgcggacgcggccctggcggcttccgacgaggcgccctgggtcatcggc
ggcggagagatctatcggttgtttctgccgttggcacaacgctgcgaagtgacggtggtg
gaggctgacgtgccgggtgacgcgcttgctccagaactcggagaaggctgggttgtcgag
gaaaatgactggcagacaagcgagtccggcttgcgctatcaattcctgagctatcggaaa
gtcgacgggtga

DBGET integrated database retrieval system