KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1838Help
Entry
MYCMA_1838        CDS       T02177                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCMA_1838
   01230 Biosynthesis of amino acids
    MYCMA_1838
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCMA_1838
   00030 Pentose phosphate pathway
    MYCMA_1838
   00051 Fructose and mannose metabolism
    MYCMA_1838
   00052 Galactose metabolism
    MYCMA_1838
  Energy metabolism
   00680 Methane metabolism
    MYCMA_1838
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MYCMA_1838
Enzymes [BR:mmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MYCMA_1838
Protein phosphatases and associated proteins [BR:mmv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MYCMA_1838
Messenger RNA biogenesis [BR:mmv03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MYCMA_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1540970..1542001
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCANRYNSQVVGFQDGWRGLLENRRIHLHNDDRNDR
LLTKGGTVLGTARTNPDRLRAGLDQIKQTLDDNGIDVLIPIGGEGTLTAASWLADENVPV
VGVPKTIDNDIDCTDVTFGFDTALTIATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALH
AGLASGAHMTLIPEVPFDVDEVCRLIKGRFQRGDSHFICVVAEGAKPAEGSMELRDGGID
EFGHQRFTGVAQQLGVEIEKRINKEVRTTVLGHVQRGGTPTPFDRVLATRFGVNAADAAH
AGEFGVMVSLRGQDIGRVPLAEATRQLKLVPKNRYEDAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggagttctcaccggtggcggcgattgtccgggcctgaatgcggtgatccgc
gcggtggtgcgaacctgcgccaaccgctacaactcgcaggtcgtgggcttccaggacggt
tggcgtggtctgttggagaaccgcagaatccaccttcacaacgacgaccgcaacgatcgg
ctgctcaccaagggtgggacggtgctcggtaccgcacgcaccaaccccgaccggctgcgt
gccggactggatcagatcaagcagaccctcgacgataacgggatcgatgtgctgatcccg
atcggcggagaaggcaccctcaccgccgccagctggctggccgacgagaacgtgcccgtg
gtcggggtgcccaagaccatcgataacgatatcgattgcaccgatgtcacattcggattc
gataccgcgctgaccatcgccaccgaggcaatcgaccggctgcacagcacagccgaatcc
catcagcgcgtcatgctggtcgaggtgatgggtcggcatgcgggctggatcgcgctgcac
gcggggctggcctcgggtgcgcatatgacgctgatccccgaagtgccgtttgatgtggat
gaggtctgtcggctgatcaaaggccgtttccagcgcggggattcgcatttcatctgtgtg
gtggccgagggtgccaagccggccgagggctcaatggagctgcgcgacgggggaattgac
gagtttgggcatcagcgattcaccggggtggcgcagcagctgggggtggagattgagaag
cgcatcaacaaagaggtgcgcaccacggtgctggggcatgtgcagcgtggcggcaccccc
acgcccttcgacagggtgctcgccacccgattcggcgtcaacgccgccgacgccgcgcac
gcgggggagttcggagtgatggtgtcgctgcgcggccaagacatcgggcgggtacccctg
gcggaagcgacccgtcagctcaagctggtccccaaaaaccgctacgaggatgccgccgcg
ttcttcggctga

DBGET integrated database retrieval system