KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1847Help
Entry
MYCMA_1847        CDS       T02177                                 

Gene name
yngF
Definition
enoyl-CoA hydratase/isomerase yngF
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYCMA_1847 (yngF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCMA_1847 (yngF)
   00650 Butanoate metabolism
    MYCMA_1847 (yngF)
  Lipid metabolism
   00071 Fatty acid degradation
    MYCMA_1847 (yngF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCMA_1847 (yngF)
   00310 Lysine degradation
    MYCMA_1847 (yngF)
   00360 Phenylalanine metabolism
    MYCMA_1847 (yngF)
   00380 Tryptophan metabolism
    MYCMA_1847 (yngF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCMA_1847 (yngF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYCMA_1847 (yngF)
   00281 Geraniol degradation
    MYCMA_1847 (yngF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYCMA_1847 (yngF)
   00627 Aminobenzoate degradation
    MYCMA_1847 (yngF)
   00930 Caprolactam degradation
    MYCMA_1847 (yngF)
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYCMA_1847 (yngF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3399179..3400099
Genome map
AA seq 306 aa AA seqDB search
MADSLHASGSSASDPLHASGSSASDPLHASGSSVSGWKAFTVETTGHIAQVTLIGPGKGN
AMGPDFWRELPLIFAELDADPEVRAVVLAAAGRHFSYGLDLPAMAGTFMPLMAEKALAKP
RTDFLDEIRRLQASVTAVADCRKPVIAAIQGWCIGGGVDLIAAADIRYASSEAKFSVREA
KVAIVADIGSLHRLPPIIGDGHLRELAFTGKDIDAARAEKIGLVNDVFDTPEATLAAAHA
TAAEIAANPPLVVQGVKDVLGRERENVVADGLKYVSTWNAAFLPSEDLQEAIGAVFEKRE
PDFKGR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgattctcttcacgcaagcggctcatcggcgtctgatcctcttcacgcaagcggc
tcatcggcgtctgatcctcttcacgcaagcggctcatcggtgtctggctggaaagccttc
accgtcgagaccaccgggcatatcgcacaggtcaccctcatcggccccggcaagggcaac
gcgatgggacccgacttttggcgagagctaccgctgatcttcgccgagctcgacgccgac
cccgaggtacgggcggtggtgcttgcggccgccggtcggcacttcagctacggattggac
ctgccggcgatggcgggcaccttcatgccgctcatggcggagaaggcactggccaaaccg
cgcaccgacttcctcgacgagatccgccggctacaggcctcggtgacggccgtcgccgac
tgccgcaagccggtgatcgcggcaattcaaggctggtgcatcggtggcggggtggacctc
atcgccgccgccgatatccggtacgccagctccgaggcaaagttcagcgtgcgcgaggcc
aaggtggcgattgtggccgatatcggttcgctgcaccggcttccaccgatcatcggtgac
ggccacctacgcgaactggcgttcaccggcaaggacatcgacgctgcccgggccgagaag
atcgggctcgtcaacgacgtgttcgacacccccgaagcgacgctggccgccgcgcatgcc
accgcggccgagatcgcggcgaatcccccgctggtggtgcagggtgtcaaggacgtcctg
gggcgcgagcgcgagaacgtcgtggccgacggcctcaagtacgtctccacctggaatgcc
gcgttcctgccgtcggaggatctgcaggaagccatcggcgcggtcttcgagaagcgggaa
cccgacttcaaggggcgctag

DBGET integrated database retrieval system