KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1857Help
Entry
MYCMA_1857        CDS       T02177                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCMA_1857
Enzymes [BR:mmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MYCMA_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1508185..1509738)
Genome map
AA seq 517 aa AA seqDB search
MTQKVPGLFTLVLHTHLPWLANHGRWPVGEEWLYQSWSAAYLPLFKVLRALAAEGRENLL
TLGITPVVAAQLDDPHCLTGLHSWLANWQLRAFEASTISNTDAEPGTASSPEMLRAFGVR
EYQTATAALDEFDTYWRHGGSGPLRNLIDAKAIELLGGPLAHPFQPLLHPRLREFALREG
LADAAQRFGHAPTGIWAPECAYAPGMEEGYAAAGVKHFMVDGPSLQGDTSLGRTVGDSDV
VAFGRDLTVSYRVWSPKSGYPGHAAYRDFHTYDHDTGLKPARVTGRNVPSESKAPYDPER
ANAAIDIHVRDFVDTVRQRLIDESSRIGRPAHVIAAFDTELYGHWWYEGPAWLERVLRAL
PEAGIQVGTLEQAREQGYVGESFDLPASSWGSGKDWHVWNGEKVADLVQLNTEVVDTALT
AVDKALNEQPAPHTRNRVADQILREALLTVSSDWPFMVSKDSAADYARYRAHLHAHATRE
IAGALASGRHDVASRLAEGWNRADGLFGALDARRLPR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaaaggttcccgggcttttcacgctggtgctacatacacacctaccgtggctg
gccaaccatgggcgctggccggtcggcgaggagtggctataccagtcttggtccgccgca
tacctgccgctgttcaaggtgttgcgcgcactggccgccgagggccgggagaacctgctc
acgctgggcatcacccccgtggtggccgcgcagctggacgatccgcactgcttgaccggg
ctgcacagctggctcgccaactggcagctgcgcgcattcgaggcttccacaatcagcaac
accgatgccgaaccgggcaccgcgtcgagcccggaaatgttgcgagcgttcggagttcgc
gagtatcagactgctaccgctgccctcgatgagttcgacacgtactggcgtcacggcggc
agcggaccgctgcgcaacctgatcgatgccaaggccatcgaactgctgggcggtccactg
gctcatccgttccagccgctgctgcatccacgcctgcgtgagttcgcactgcgcgaagga
ttggcagatgccgcacagcgtttcgggcatgcacccaccggtatttgggcgcccgagtgc
gcctacgccccaggcatggaagagggctacgcggcggcaggcgtcaagcacttcatggtg
gatggtccgtccctacagggagacacgtcgctgggccgcacggtgggcgactccgacgtg
gttgccttcggccgcgacctgacggtgagctaccgcgtgtggtccccgaagtctggatat
ccgggccatgccgcctaccgcgacttccacacctacgaccatgacaccggcctcaagccg
gcccgtgtcaccggacgcaatgtgccatcggaatccaaggcaccctatgaccccgagcgc
gccaatgccgcgatcgacatccatgtccgcgatttcgtggacaccgtccgccagcgcctc
atcgacgaatccagccgcatcgggcggcccgcacacgtcatcgccgccttcgacaccgaa
ctctatggacactggtggtacgaagggcccgcctggctagaacgggtactgcgcgcgcta
cccgaagccggtattcaggtgggcacgctggagcaggcccgcgagcagggatatgtgggc
gagtcgttcgacttgcccgccagttcatggggctccggcaaggattggcatgtgtggaac
ggcgagaaggtagccgacctggtgcagctgaacaccgaggtcgtcgacaccgcgctcacc
gcagtggacaaggctctcaatgaacaacccgcgccgcatacccgcaaccgggtggccgac
cagatattgcgcgaagccctgttgaccgtgtccagcgactggccgttcatggtcagcaag
gattccgcggccgactacgcgcgctaccgcgcgcacctgcacgcacacgccacccgcgag
atagccggagccctggccagcggacgccacgacgtggcatctcgattggcggagggttgg
aatcgcgcggacggattgttcggcgcgcttgatgcccggaggctgccccgatga

DBGET integrated database retrieval system