KEGG   Mycobacterium massiliense: MYCMA_1857Help
Entry
MYCMA_1857        CDS       T02177                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmv  Mycobacterium massiliense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3416349..3417869
Genome map
AA seq 506 aa AA seqDB search
MLHTHLPWLANHGRWPVGEEWLYQSWSAAYLPLFKVLRALAAEGRENLLTLGITPVVAAQ
LDDPHCLTGLHSWLANWQLRAFEASTISNTDAEPGTASSPEMLRAFGVREYQTATAALDE
FDTYWRHGGSGPLRNLIDAKAIELLGGPLAHPFQPLLHPRLREFALREGLADAAQRFGHA
PTGIWAPECAYAPGMEEGYAAAGVKHFMVDGPSLQGDTSLGRTVGDSDVVAFGRDLTVSY
RVWSPKSGYPGHAAYRDFHTYDHDTGLKPARVTGRNVPSESKAPYDPERANAAIDIHVRD
FVDTVRQRLIDESSRIGRPAHVIAAFDTELYGHWWYEGPAWLERVLRALPEAGIQVGTLE
QAREQGYVGESFDLPASSWGSGKDWHVWNGEKVADLVQLNTEVVDTALTAVDKALNEQPA
PHTRNRVADQILREALLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRHD
VASRLAEGWNRADGLFGALDARRLPR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgctacatacacacctaccgtggctggccaaccatgggcgctggccggtcggcgaggag
tggctataccagtcttggtccgccgcatacctgccgctgttcaaggtgttgcgcgcactg
gccgccgagggccgggagaacctgctcacgctgggcatcacccccgtggtggccgcgcag
ctggacgatccgcactgcttgaccgggctgcacagctggctcgccaactggcagctgcgc
gcattcgaggcttccacaatcagcaacaccgatgccgaaccgggcaccgcgtcgagcccg
gaaatgttgcgagcgttcggagttcgcgagtatcagactgctaccgctgccctcgatgag
ttcgacacgtactggcgtcacggcggcagcggaccgctgcgcaacctgatcgatgccaag
gccatcgaactgctgggcggtccactggctcatccgttccagccgctgctgcatccacgc
ctgcgtgagttcgcactgcgcgaaggattggcagatgccgcacagcgtttcgggcatgca
cccaccggtatttgggcgcccgagtgcgcctacgccccaggcatggaagagggctacgcg
gcggcaggcgtcaagcacttcatggtggatggtccgtccctacagggagacacgtcgctg
ggccgcacggtgggcgactccgacgtggttgccttcggccgcgacctgacggtgagctac
cgcgtgtggtccccgaagtctggatatccgggccatgccgcctaccgcgacttccacacc
tacgaccatgacaccggcctcaagccggcccgtgtcaccggacgcaatgtgccatcggaa
tccaaggcaccctatgaccccgagcgcgccaatgccgcgatcgacatccatgtccgcgat
ttcgtggacaccgtccgccagcgcctcatcgacgaatccagccgcatcgggcggcccgca
cacgtcatcgccgccttcgacaccgaactctatggacactggtggtacgaagggcccgcc
tggctagaacgggtactgcgcgcgctacccgaagccggtattcaggtgggcacgctggag
caggcccgcgagcagggatatgtgggcgagtcgttcgacttgcccgccagttcatggggc
tccggcaaggattggcatgtgtggaacggcgagaaggtagccgacctggtgcagctgaac
accgaggtcgtcgacaccgcgctcaccgcagtggacaaggctctcaatgaacaacccgcg
ccgcatacccgcaaccgggtggccgaccagatattgcgcgaagccctgttgaccgtgtcc
agcgactggccgttcatggtcagcaaggattccgcggccgactacgcgcgctaccgcgcg
cacctgcacgcacacgccacccgcgagatagccggagccctggccagcggacgccacgac
gtggcatctcgattggcggagggttggaatcgcgcggacggattgttcggcgcgcttgat
gcccggaggctgccccgatga

DBGET integrated database retrieval system