KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1858Help
Entry
MYCMA_1858        CDS       T02177                                 

Definition
glycogen synthase (EC:2.4.1.11)
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCMA_1858
Enzymes [BR:mmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MYCMA_1858
Glycosyltransferases [BR:mmv01003]
 Polysaccharide
  Storage polysaccharide
   MYCMA_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3417991..3419235
Genome map
AA seq 414 aa AA seqDB search
MRILMVSWEYPPVVIGGLGRHVHHLSTELAAAGHDVVVLTRRPSGTDPSSHPTSDEISEG
VRVVAAAEDPHDFDFGTDMMAWTLAMGHAMVRAGLALGLKGSGDWRPDVVHAHDWLVAHP
AIALAEHFDVPLVSTLHATEAGRHSGWVSGRISRQVHSVEWWLARESDSLITCSASMLDE
VTQLFGPELPQVHVIRNGIDVTRWVFAPRPPADGTPPVLLFVGRLEYEKGIHDAIAALPK
IRRAHPGTVLAVAGDGTQQDWLLEQARKYKVVKSVQFLGTLDHSELLHWLHHADAILLPS
HYEPFGIVALEAAAAGTPLVTSTVGGLGEAVIDGETGMSFAPRDVAGIAEAVTRTLDDPA
AAAERAVAARARLTADFDWATVADETAQVYLAAKRREREPLGRSVIVERPLPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagaattctgatggtctcgtgggagtacccgccggtggtcatcggcggactgggccga
cacgtgcatcacctgtccaccgaattggccgccgccggacacgacgtggtggtgctgacc
cgccgcccctcgggcaccgacccgtcgagtcatccgacctccgacgaaatttccgaaggc
gtccgtgtggtcgctgccgccgaggacccccacgacttcgacttcggcaccgacatgatg
gcctggacgctcgccatgggacacgccatggtgcgggcgggattagccctgggcctcaag
ggatccggtgattggcgccccgacgtggtccacgcgcatgactggctggtcgcccacccc
gctatcgcgctggccgaacatttcgatgtcccgctggtgtccacgctgcacgccaccgag
gccggccgccacagcggctgggtgtctgggcgcatcagccggcaggtgcactcggtggaa
tggtggctggctcgcgaatcggactcgctgatcacctgctcggcctcgatgctcgacgag
gtgactcagctatttgggccggagctgccacaggtccacgtcatccgcaacggaatcgac
gtcactcgttgggtcttcgcgccccgaccacccgcagacggcactcctccggtgctgctt
tttgtggggcggctcgaatacgagaagggcatccacgacgcgatcgcggcgctgcccaag
atccgccgtgcgcaccccggaaccgtgctggcggtggccggcgatggtacacaacaggat
tggctgctggaacaggcgcgcaaatacaaggtcgtaaagtctgtccagttcctgggcacc
ctcgaccattcggagttgctgcactggttacatcatgccgacgccatcctactgcccagc
cactacgaaccgttcggcatcgtggcattggaggccgcggccgccggtactcccctggtg
acctcgaccgtcggcggtctcggtgaggcggtcatcgatggtgagacgggaatgtccttt
gcgccacgcgacgtggccggtattgccgaggcggtcactcgcacgctcgacgaccctgcc
gctgccgccgagcgggcggtagccgcacgggcgcggctcaccgcggacttcgactgggcc
actgtcgccgacgaaaccgcacaggtgtatttggcagccaagcgtcgcgagcgagagcca
ctgggccgcagcgtcatcgtcgagcgtcccctgccggaccggtaa

DBGET integrated database retrieval system