KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1864Help
Entry
MYCMA_1864        CDS       T02177                                 

Gene name
echA17
Definition
enoyl-CoA hydratase echA17 (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYCMA_1864 (echA17)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCMA_1864 (echA17)
   00650 Butanoate metabolism
    MYCMA_1864 (echA17)
  Lipid metabolism
   00071 Fatty acid degradation
    MYCMA_1864 (echA17)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCMA_1864 (echA17)
   00310 Lysine degradation
    MYCMA_1864 (echA17)
   00360 Phenylalanine metabolism
    MYCMA_1864 (echA17)
   00380 Tryptophan metabolism
    MYCMA_1864 (echA17)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCMA_1864 (echA17)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYCMA_1864 (echA17)
   00281 Geraniol degradation
    MYCMA_1864 (echA17)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYCMA_1864 (echA17)
   00627 Aminobenzoate degradation
    MYCMA_1864 (echA17)
   00930 Caprolactam degradation
    MYCMA_1864 (echA17)
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYCMA_1864 (echA17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3433066..3433860)
Genome map
AA seq 264 aa AA seqDB search
MTEPEFVAVRTAPEHPGIGTIALSRPPTNTLTRQMYRELAQAAAEVNAREDIRVVIVYGG
HEIFCAGDDLAELSELSADEMARSAGDRQAALTAVAQLAKPTIAAITGYALGSGLELALT
ADWRIAGDNVKVGSPEILVGMIPGGGGTVRLARVVGLSRAKEMVFSGRFVGADEARGAGL
IDQVVAPDDVYTEAATWARRFVDGPPLALAAAKEAIDRGFDGPLAAGLDKERELFCQVFA
TQDRAEGVAAQLEIGPGTARFRGA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcccgaattcgtcgcggtgcgcaccgcgcccgagcatcccggcatcggcacc
atcgcgttgtcgcggccgcccaccaacaccttgacccggcagatgtatcgcgaactggcc
caggccgccgccgaggtgaacgcacgcgaagacatcagggttgtcatcgtctacggagga
cacgagattttctgcgccggtgacgatttggcggaactttcggagctgtccgccgatgag
atggcgcgcagtgccggtgatcggcaggccgcgcttaccgcggtggcgcagctggccaaa
cccacgattgccgcgatcacggggtatgcgctgggcagcggactggagctggccctgacg
gccgactggcggatcgcgggggacaacgtcaaggtgggttcgccggagatcctggtcggc
atgattccgggtggcggtgggactgtccgactggcgcgtgtggtgggtctgagccgggcc
aaggagatggtcttcagcggccgcttcgtgggagctgacgaagcacggggcgctggactc
atcgatcaggtggtggcgcccgacgatgtgtacacagaggccgcgacctgggcccggcgc
tttgtcgatgggccgccgctggcgctcgctgccgccaaggaagccatcgaccgtggattc
gacggtccgctggccgcgggactggacaaggaacgtgagctgttttgccaggtgtttgcg
acacaggaccgggcggagggagtcgccgctcagctggagatcggcccggggacggcccgg
ttcaggggagcctaa

DBGET integrated database retrieval system