KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1936Help
Entry
MYCMA_1936        CDS       T02177                                 

Definition
(GenBank) uroporphyrinogen III synthetase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
mmv00860  Porphyrin and chlorophyll metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYCMA_1936
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MYCMA_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AFN64068
Position
1354666..1355820
Genome map
AA seq 384 aa AA seqDB search
MPRNEPERRLDGFTIGVTAARRSEELIALLERRGAAVVHAAAIRIIPLADDAELREATEL
VIANPPDLTVATTGIGFRGWIEAADEWGVADGLKSALESGRLVARGPKATGAIRQAGLRE
EWSPASESSAEVLDRLLEEGVEGRRIAVQLHGAATEWEPIADLCEALTIAGAQVIRVPVY
RWEPPEDQRPMDRLISMAINAELDGISFTSAPAVASMLGRAKATGRLDELLAALRARVAP
LCVGPVTAAPLEVLGVPTTQPERARLGALARHIADELTRRAPRFHAGGHIVSVRSCGIAV
DGETRQISPAGMALMKRLMVRPGQVVSREDLLAALPGGGDDTHAVETAMTRLRAALGAPK
VIQTVVKRGYRLAIDPTTIGECHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgtaacgagccagaacgtcggctcgatgggttcacgatcggtgtgaccgccgcg
cgccgttcggaggaactgatcgcgctgttggagcgtcgcggggccgctgtggtgcatgcc
gcggccatcaggatcatcccgctggccgacgatgcggaacttcgggaagcgaccgagctc
gtcatcgccaacccgcccgatctgactgtggccaccaccggcatcggtttccgcggctgg
atcgaggctgccgatgagtggggtgtggccgacggtctcaagtcggcgttggagtccggg
cgtttggtcgctcgtggacccaaggccaccggagcgatccgtcaggcggggttgcgtgaa
gaatggtcgcccgcatcggaatcgtcggcagaggtattggatcgtctgctcgaagaaggt
gtcgagggtcggcgtatcgccgtgcaactacatggcgctgccaccgaatgggagcccatc
gctgacctatgcgaggcgctgaccatcgctggcgcgcaagtgatccgggtgccggtgtac
cgttgggagcccccggaggaccagcggccgatggaccgcttgatctccatggcgatcaac
gccgagctcgacgggatcagttttaccagtgcgcccgcggtggcctcgatgttggggcgt
gccaaggcgaccggccgtttggatgagctgctggccgcgttgcgggcccgggtggcgccg
ttgtgcgttggaccggtgaccgcggccccgctggaggtactcggtgtgcccaccacgcag
cccgagcgggcgcggctgggtgcattggccaggcacattgccgatgaactgacccggcgg
gcgccacggttccacgccggcgggcatatcgtcagcgtgcgcagctgcgggatcgcggtt
gatggtgaaactcgccagatctcgccggcgggaatggcgttgatgaagcgtctgatggtg
cgccccggccaggtggtgtcccgtgaggatctgctggccgcactgccgggcggcggtgac
gacacccatgccgtcgagacggcgatgactcgcctgcgagcggcccttggtgcgccgaaa
gtgattcagacagtggtcaagcggggttaccggttggcgatcgatccgaccacgattggg
gaatgtcatggctga

DBGET integrated database retrieval system