KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_1936Help
Entry
MYCMA_1936        CDS       T02177                                 

Definition
uroporphyrinogen III synthetase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYCMA_1936
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MYCMA_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1354666..1355820
Genome map
AA seq 384 aa AA seqDB search
MPRNEPERRLDGFTIGVTAARRSEELIALLERRGAAVVHAAAIRIIPLADDAELREATEL
VIANPPDLTVATTGIGFRGWIEAADEWGVADGLKSALESGRLVARGPKATGAIRQAGLRE
EWSPASESSAEVLDRLLEEGVEGRRIAVQLHGAATEWEPIADLCEALTIAGAQVIRVPVY
RWEPPEDQRPMDRLISMAINAELDGISFTSAPAVASMLGRAKATGRLDELLAALRARVAP
LCVGPVTAAPLEVLGVPTTQPERARLGALARHIADELTRRAPRFHAGGHIVSVRSCGIAV
DGETRQISPAGMALMKRLMVRPGQVVSREDLLAALPGGGDDTHAVETAMTRLRAALGAPK
VIQTVVKRGYRLAIDPTTIGECHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgtaacgagccagaacgtcggctcgatgggttcacgatcggtgtgaccgccgcg
cgccgttcggaggaactgatcgcgctgttggagcgtcgcggggccgctgtggtgcatgcc
gcggccatcaggatcatcccgctggccgacgatgcggaacttcgggaagcgaccgagctc
gtcatcgccaacccgcccgatctgactgtggccaccaccggcatcggtttccgcggctgg
atcgaggctgccgatgagtggggtgtggccgacggtctcaagtcggcgttggagtccggg
cgtttggtcgctcgtggacccaaggccaccggagcgatccgtcaggcggggttgcgtgaa
gaatggtcgcccgcatcggaatcgtcggcagaggtattggatcgtctgctcgaagaaggt
gtcgagggtcggcgtatcgccgtgcaactacatggcgctgccaccgaatgggagcccatc
gctgacctatgcgaggcgctgaccatcgctggcgcgcaagtgatccgggtgccggtgtac
cgttgggagcccccggaggaccagcggccgatggaccgcttgatctccatggcgatcaac
gccgagctcgacgggatcagttttaccagtgcgcccgcggtggcctcgatgttggggcgt
gccaaggcgaccggccgtttggatgagctgctggccgcgttgcgggcccgggtggcgccg
ttgtgcgttggaccggtgaccgcggccccgctggaggtactcggtgtgcccaccacgcag
cccgagcgggcgcggctgggtgcattggccaggcacattgccgatgaactgacccggcgg
gcgccacggttccacgccggcgggcatatcgtcagcgtgcgcagctgcgggatcgcggtt
gatggtgaaactcgccagatctcgccggcgggaatggcgttgatgaagcgtctgatggtg
cgccccggccaggtggtgtcccgtgaggatctgctggccgcactgccgggcggcggtgac
gacacccatgccgtcgagacggcgatgactcgcctgcgagcggcccttggtgcgccgaaa
gtgattcagacagtggtcaagcggggttaccggttggcgatcgatccgaccacgattggg
gaatgtcatggctga

DBGET integrated database retrieval system