KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_2017Help
Entry
MYCMA_2017        CDS       T02177                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MYCMA_2017 (deoA)
Enzymes [BR:mmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MYCMA_2017 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3725186..3726475)
Genome map
AA seq 429 aa AA seqDB search
MANTYIFDMPSIIATKRDGAELSPAAIDWLIGQYTSGDIGEEQVAALLMAIYLRGMNGAE
TAAWTAAILASGERLDLSGLSRPTVDKHSTGGVGDKISLPLVAVVAACGAAVPQLSGRGL
GHTGGTLDKLESVAGIRVDLSNDQIRQQLSDVGAVICAAGASLAPADRKLYALRDITGTV
ESIPLIAGSIMSKKLAEGTAALVLDVKVGAGAFMKSEQRARELASAMVDLGTAHGVATSA
LLTAMDTPLGATAGNAVEVQESLDVLAGGGPEDVVALTVTLAREMLAAAGIDGKDPAATL
TDGTAMDVFRAMIHAQGGDLAVPLPLGRCQETVLAPVGGVMRRIDAMPVGIAAWRLGAGR
SRPGEVVQHGAGVRIHRRPGDAVVAGEPLFTLYTDTQERLPAALDALEGGWEIGAAPTAT
PLIIDRLPV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatacatacatcttcgatatgccgtcgatcatcgccaccaagcgggacggcgcg
gagctgagcccggccgccatcgattggctgatcggccagtacaccagcggcgacatcggt
gaggaacaggtcgcggccctgctgatggcgatttatctgcgcggcatgaacggcgccgag
acggcggcgtggacagcggcgatcctggcgtccggcgagcgactggacctgtccgggttg
tcccggccgaccgtcgacaagcactccaccggcggagtgggcgacaagatcagcttgccg
ctggtcgccgtcgtcgcggcgtgcggagcggcagttccacagctttccggacgtggcctc
ggacacaccggcggcactctcgacaagctcgaatccgttgcgggtatccgtgtcgatctc
tccaatgaccagatacgtcagcagctttccgacgtgggggcggtgatctgcgcggccggg
gcgtcattggcgcccgccgaccgaaagctctacgcgctgcgggatatcaccggcaccgtc
gagtcgattccgctcatcgccgggtcgatcatgagtaagaagctggcggaaggtaccgcc
gcgctggttctggacgtcaaggtcggcgcgggcgcgttcatgaaatccgaacagcgcgct
cgtgaattggcctcggcgatggtcgatctgggtaccgcgcacggggtggccaccagcgcc
ctgctgaccgcgatggacaccccattgggggccaccgcgggaaacgcggtcgaggtgcag
gaatcgctcgacgtgctggcggggggagggccggaggatgttgtcgcgctcaccgtgacg
ctggcccgcgagatgctcgcggcggccgggatcgacggcaaggatccggccgcgacgctg
accgacggcaccgccatggacgtgttccgcgcgatgatccacgcgcagggtggtgacctc
gccgtgccgctaccgctggggcggtgtcaggagaccgtgctggccccggtcggtggtgtc
atgcgccgtatcgacgcgatgcctgtcgggatcgcggcctggcgcctaggtgccggacgc
agccgcccgggggaggtggtgcagcacggtgccggggtgcgcattcaccgcagaccgggc
gacgcggtggtagccggagaaccactgttcactctgtataccgacacccaggagcgattg
cccgccgcgctcgacgcgctggaaggtgggtgggagatcggtgcggcaccgaccgctacc
cccctcatcatcgatagacttccggtgtga

DBGET integrated database retrieval system