KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_2017Help
Entry
MYCMA_2017        CDS       T02177                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00240  Pyrimidine metabolism
mmv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MYCMA_2017
Enzymes [BR:mmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MYCMA_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N DUF2254
Motif
Other DBs
NCBI-ProteinID: AFN64149
Position
1216593..1217882
Genome map
AA seq 429 aa AA seqDB search
MANTYIFDMPSIIATKRDGAELSPAAIDWLIGQYTSGDIGEEQVAALLMAIYLRGMNGAE
TAAWTAAILASGERLDLSGLSRPTVDKHSTGGVGDKISLPLVAVVAACGAAVPQLSGRGL
GHTGGTLDKLESVAGIRVDLSNDQIRQQLSDVGAVICAAGASLAPADRKLYALRDITGTV
ESIPLIAGSIMSKKLAEGTAALVLDVKVGAGAFMKSEQRARELASAMVDLGTAHGVATSA
LLTAMDTPLGATAGNAVEVQESLDVLAGGGPEDVVALTVTLAREMLAAAGIDGKDPAATL
TDGTAMDVFRAMIHAQGGDLAVPLPLGRCQETVLAPVGGVMRRIDAMPVGIAAWRLGAGR
SRPGEVVQHGAGVRIHRRPGDAVVAGEPLFTLYTDTQERLPAALDALEGGWEIGAAPTAT
PLIIDRLPV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatacatacatcttcgatatgccgtcgatcatcgccaccaagcgggacggcgcg
gagctgagcccggccgccatcgattggctgatcggccagtacaccagcggcgacatcggt
gaggaacaggtcgcggccctgctgatggcgatttatctgcgcggcatgaacggcgccgag
acggcggcgtggacagcggcgatcctggcgtccggcgagcgactggacctgtccgggttg
tcccggccgaccgtcgacaagcactccaccggcggagtgggcgacaagatcagcttgccg
ctggtcgccgtcgtcgcggcgtgcggagcggcagttccacagctttccggacgtggcctc
ggacacaccggcggcactctcgacaagctcgaatccgttgcgggtatccgtgtcgatctc
tccaatgaccagatacgtcagcagctttccgacgtgggggcggtgatctgcgcggccggg
gcgtcattggcgcccgccgaccgaaagctctacgcgctgcgggatatcaccggcaccgtc
gagtcgattccgctcatcgccgggtcgatcatgagtaagaagctggcggaaggtaccgcc
gcgctggttctggacgtcaaggtcggcgcgggcgcgttcatgaaatccgaacagcgcgct
cgtgaattggcctcggcgatggtcgatctgggtaccgcgcacggggtggccaccagcgcc
ctgctgaccgcgatggacaccccattgggggccaccgcgggaaacgcggtcgaggtgcag
gaatcgctcgacgtgctggcggggggagggccggaggatgttgtcgcgctcaccgtgacg
ctggcccgcgagatgctcgcggcggccgggatcgacggcaaggatccggccgcgacgctg
accgacggcaccgccatggacgtgttccgcgcgatgatccacgcgcagggtggtgacctc
gccgtgccgctaccgctggggcggtgtcaggagaccgtgctggccccggtcggtggtgtc
atgcgccgtatcgacgcgatgcctgtcgggatcgcggcctggcgcctaggtgccggacgc
agccgcccgggggaggtggtgcagcacggtgccggggtgcgcattcaccgcagaccgggc
gacgcggtggtagccggagaaccactgttcactctgtataccgacacccaggagcgattg
cccgccgcgctcgacgcgctggaaggtgggtgggagatcggtgcggcaccgaccgctacc
cccctcatcatcgatagacttccggtgtga

DBGET integrated database retrieval system