KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_2082Help
Entry
MYCMA_2082        CDS       T02177                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00521  Streptomycin biosynthesis
mmv00523  Polyketide sugar unit biosynthesis
mmv01130  Biosynthesis of antibiotics
Module
mmv_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MYCMA_2082
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MYCMA_2082
Enzymes [BR:mmv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MYCMA_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AFN64214
Position
complement(1110970..1111587)
Genome map
AA seq 205 aa AA seqDB search
MDIRELSVPGSFEITPVQHHDSRGVFLELFKGPALAEAIGHPFELQQANCSVSAAGSLRG
IHFADVPPGQAKYVTCLTGSVYDVVVDIRVGSPTFGAWDAVLLDPRDRRAVYVPEGVGHG
FLALEDDSTVVYLCSAGYAPGREHGIDPLDPTVGIPWPTRRPDGTELSLLVSEKDGAAPS
LLDARDSGLLPDAAEVQAFLDGLSG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggatatccgcgaactttcggtgcccggttccttcgagatcaccccggtacagcatcat
gacagccgcggagttttcctcgaattgttcaagggcccagcgcttgccgaggccatcggg
catccgttcgagctgcagcaggccaactgttcggtgtcggcagccggatcgctgcgcggt
atccatttcgccgacgtaccacccggccaggccaaatacgtgacctgtctgaccggttcc
gtgtacgacgtcgtggtcgacatccgtgtcggctcaccgacgttcggcgcttgggacgcc
gtgcttctcgacccccgcgaccggcgggccgtctacgttcccgagggggtggggcacggt
ttcctcgcactcgaggatgactccacggtggtctatctctgctccgccggatatgccccc
ggccgcgagcacggcatcgatccactggacccaacagtcgggatcccgtggccgacccgc
aggcccgacggtaccgagctttcactactcgtttccgaaaaggacggtgctgcaccgtca
ttgctggatgccagggattcgggtctgttgcccgacgccgccgaggtgcaggctttcctc
gacggcctgtccggctga

DBGET integrated database retrieval system