KEGG   Mycobacterium massiliense: MYCMA_2082Help
Entry
MYCMA_2082        CDS       T02177                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mmv  Mycobacterium massiliense
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:mmv00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mmv00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3836995..3837612
Genome map
AA seq 205 aa AA seqDB search
MDIRELSVPGSFEITPVQHHDSRGVFLELFKGPALAEAIGHPFELQQANCSVSAAGSLRG
IHFADVPPGQAKYVTCLTGSVYDVVVDIRVGSPTFGAWDAVLLDPRDRRAVYVPEGVGHG
FLALEDDSTVVYLCSAGYAPGREHGIDPLDPTVGIPWPTRRPDGTELSLLVSEKDGAAPS
LLDARDSGLLPDAAEVQAFLDGLSG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggatatccgcgaactttcggtgcccggttccttcgagatcaccccggtacagcatcat
gacagccgcggagttttcctcgaattgttcaagggcccagcgcttgccgaggccatcggg
catccgttcgagctgcagcaggccaactgttcggtgtcggcagccggatcgctgcgcggt
atccatttcgccgacgtaccacccggccaggccaaatacgtgacctgtctgaccggttcc
gtgtacgacgtcgtggtcgacatccgtgtcggctcaccgacgttcggcgcttgggacgcc
gtgcttctcgacccccgcgaccggcgggccgtctacgttcccgagggggtggggcacggt
ttcctcgcactcgaggatgactccacggtggtctatctctgctccgccggatatgccccc
ggccgcgagcacggcatcgatccactggacccaacagtcgggatcccgtggccgacccgc
aggcccgacggtaccgagctttcactactcgtttccgaaaaggacggtgctgcaccgtca
ttgctggatgccagggattcgggtctgttgcccgacgccgccgaggtgcaggctttcctc
gacggcctgtccggctga

DBGET integrated database retrieval system