KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_2280Help
Entry
MYCMA_2280        CDS       T02177                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00630  Glyoxylate and dicarboxylate metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
mmv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MYCMA_2280
Enzymes [BR:mmv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MYCMA_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFN64408
Position
809709..811001
Genome map
AA seq 430 aa AA seqDB search
MSNVGKPRTAAEIQQDWDTNPRWKGITRDYTAAQVEELQGSVVEENTLARRGAEILWDAV
TKDDDSYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVP
AVVRRINNALLRADEIARVEGDTSVDNWLVPIVADGEAGFGGALNVYELQKAMIAAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVANTPTVVIARTDAEAATLIT
SDVDERDKPFVTGERTSEGFYNVQKGIEPCIARAKAYAPYADLIWMETGVPDLEVARKFA
EAVKADFPDQLLSYNCSPSFNWKQHLDDSTIAKFQKELGAMGFKFQFITLAGFHALNYSM
FDLAYGYAREGMTAYVDLQEREFASEARGYTATKHQREVGAGYFDKIATTVDPNTSTAAL
KGSTEEGQFH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgtcggcaagccgcgcaccgcggccgaaatccagcaggactgggacaccaac
ccccgctggaagggcatcacccgcgactacaccgccgcccaggttgaggagctgcagggc
agcgtcgtcgaggagaacacccttgcccgccgtggcgccgagatcctgtgggacgccgtc
accaaggacgacgactcgtacatcaacgcgctgggtgccctgaccggcaacatggccgtt
cagcaggtccgcgccggccttaaggccatctacctgtccggttggcaggtcgccggtgac
gccaacctttccggccacacctacccggaccagagcctgtacccggccaactcggtgccg
gccgtggttcgccgcatcaacaacgccctgctgcgggccgacgagatcgcccgcgtcgag
ggcgacaccagcgtcgacaactggctcgtgccgatcgtcgccgacggtgaggccggcttc
ggtggcgcgctgaacgtctacgaactgcagaaggccatgatcgccgcgggtgccgccggt
acccactgggaggaccagctggcctcggagaagaagtgcggccacctcggtggcaaggtg
ctgattcccacccagcagcacatccgcacgctgacctctgctcgcctggccgccgacgtc
gccaacaccccgaccgtcgtcatcgcccgcaccgatgccgaggccgccaccctcatcacc
tccgatgtggatgagcgtgacaagccgttcgtcaccggtgagcgcacctccgagggcttc
tacaacgtgcagaagggcatcgagccctgtatcgcgcgcgccaaggcatacgctccgtac
gccgacctcatctggatggagaccggtgtgccggacctcgaggtcgctcgcaagttcgcc
gaggccgtcaaggccgacttcccggaccagctgctgtcctacaactgcagcccgtccttc
aactggaagcagcacctggacgactcgaccatcgccaagttccagaaggaactgggtgcc
atgggcttcaagttccagttcatcaccctggccggcttccacgccctgaactactcgatg
ttcgacctggcctacggttacgcccgcgagggcatgacggcctacgtcgacctgcaggag
cgtgagttcgcttccgaggcgcgtggctacaccgccaccaagcaccagcgcgaggttggc
gccggttacttcgacaagatcgccaccacggtcgacccgaacacctcgaccgcggcgctg
aagggctcgaccgaagagggccagttccactga

DBGET integrated database retrieval system