KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_2389Help
Entry
MYCMA_2389        CDS       T02177                                 

Gene name
agaA
Definition
alpha-galactosidase A (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MYCMA_2389 (agaA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYCMA_2389 (agaA)
   00600 Sphingolipid metabolism
    MYCMA_2389 (agaA)
Enzymes [BR:mmv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MYCMA_2389 (agaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4381050..4382345
Genome map
AA seq 431 aa AA seqDB search
MSRGRRALILIMLAVIGIVATVLSVHIFRRQPQPGPAIAGLASTPPLGWNSWNVFGCNID
EQRIERTAQAMVSSGMRDAGYRYVVVDDCWFDPRRDASGELRANPARFPHGMKAVADFVH
ARGLLFGIYASPGEATCAQNGGSYPGRTGSRGHEIQDAQTFARWGVDYLKYDWCGPPADV
DELVDSFTIMRDALRATGRPILYSINPNSGTVIPPSRYDSFTGVATMTRVSQDLVPAWDA
IDAYDTSLGVVDALTNAAGPAFRCTPQPGFFCDYDMLVAGAPQVAGIDLPPLNAAESRAQ
LALWAEWGSPLIAGNDLTHMPEDIRALLINRDLLAIDQDSLRASATALAGSGGTIWTRPL
GDGSTAIVIVNRDDAAQPFRAAFSALGLPKARRFDVLDVFSGQRSVQPLTYRTSLAAHDA
MLLRVRAIGDQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtggccgccgtgcactgatcctgatcatgcttgcggtgatcggcatcgtggca
acggtgctgtccgttcacattttccgccgccagccacagcccggcccggccatcgccggg
ctggcatcgactcccccgctggggtggaattcgtggaatgtgttcggctgcaatattgat
gagcagcgcatcgagcgaacggcgcaggccatggtgtcgtcgggaatgcgcgatgccgga
tatcggtatgtggtggtcgacgactgctggttcgatccacggcgcgacgcgtcaggggaa
ctgcgcgcgaaccccgcccgttttcctcacggcatgaaggcagtggccgacttcgtgcac
gcacgcggtctgttgttcggcatctacgccagccccggcgaggctacctgcgcgcagaac
ggcggttcgtacccgggccgcacgggcagccgggggcacgagatccaggatgcccagacc
ttcgcacggtggggcgtggattacttgaagtacgactggtgtgggccacccgccgacgtc
gacgaactggtcgacagcttcaccatcatgcgggatgcgttgcgcgccaccggcagaccg
atcctctacagcatcaacccgaacagcggcaccgtcatcccgcccagccggtacgacagc
ttcaccggggtagccaccatgactcgggtgagtcaagacttggtaccggcatgggatgcc
atcgacgcctacgacaccagcctcggcgtcgtcgacgcgttgaccaacgcagcagggccc
gcgttccgttgcacaccgcagccgggcttcttctgcgattacgacatgctggtcgccggg
gcaccacaggtcgcgggaattgatctgccgccgctcaatgcggccgaatcacgagcacag
ctcgccctatgggcggaatggggatcgcctctgatcgcgggcaacgacctgacacacatg
cccgaggacatccgtgcgctgctgatcaatcgggatctgcttgccattgatcaagattcg
ctgcgcgcgtccgcgaccgcactggcgggcagcggcggaaccatttggacccggccgctt
ggcgatggatccacggcgatcgtgattgtgaaccgcgacgacgccgcacagcctttccgg
gctgcgttcagcgcgctggggctgcccaaagcccggcggttcgacgtcctcgacgtgttc
tcgggacaacggtcggtgcagccgctgacgtatcgcaccagcctggcggcacacgatgcc
atgctgctgcgagtacgggcgatcggcgaccaataa

DBGET integrated database retrieval system