KEGG   Mycobacterium massiliense: MYCMA_2389Help
Entry
MYCMA_2389        CDS       T02177                                 

Gene name
agaA
Definition
alpha-galactosidase A (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mmv  Mycobacterium massiliense
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mmv00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mmv00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mmv00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4381050..4382345
Genome map
AA seq 431 aa AA seqDB search
MSRGRRALILIMLAVIGIVATVLSVHIFRRQPQPGPAIAGLASTPPLGWNSWNVFGCNID
EQRIERTAQAMVSSGMRDAGYRYVVVDDCWFDPRRDASGELRANPARFPHGMKAVADFVH
ARGLLFGIYASPGEATCAQNGGSYPGRTGSRGHEIQDAQTFARWGVDYLKYDWCGPPADV
DELVDSFTIMRDALRATGRPILYSINPNSGTVIPPSRYDSFTGVATMTRVSQDLVPAWDA
IDAYDTSLGVVDALTNAAGPAFRCTPQPGFFCDYDMLVAGAPQVAGIDLPPLNAAESRAQ
LALWAEWGSPLIAGNDLTHMPEDIRALLINRDLLAIDQDSLRASATALAGSGGTIWTRPL
GDGSTAIVIVNRDDAAQPFRAAFSALGLPKARRFDVLDVFSGQRSVQPLTYRTSLAAHDA
MLLRVRAIGDQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtggccgccgtgcactgatcctgatcatgcttgcggtgatcggcatcgtggca
acggtgctgtccgttcacattttccgccgccagccacagcccggcccggccatcgccggg
ctggcatcgactcccccgctggggtggaattcgtggaatgtgttcggctgcaatattgat
gagcagcgcatcgagcgaacggcgcaggccatggtgtcgtcgggaatgcgcgatgccgga
tatcggtatgtggtggtcgacgactgctggttcgatccacggcgcgacgcgtcaggggaa
ctgcgcgcgaaccccgcccgttttcctcacggcatgaaggcagtggccgacttcgtgcac
gcacgcggtctgttgttcggcatctacgccagccccggcgaggctacctgcgcgcagaac
ggcggttcgtacccgggccgcacgggcagccgggggcacgagatccaggatgcccagacc
ttcgcacggtggggcgtggattacttgaagtacgactggtgtgggccacccgccgacgtc
gacgaactggtcgacagcttcaccatcatgcgggatgcgttgcgcgccaccggcagaccg
atcctctacagcatcaacccgaacagcggcaccgtcatcccgcccagccggtacgacagc
ttcaccggggtagccaccatgactcgggtgagtcaagacttggtaccggcatgggatgcc
atcgacgcctacgacaccagcctcggcgtcgtcgacgcgttgaccaacgcagcagggccc
gcgttccgttgcacaccgcagccgggcttcttctgcgattacgacatgctggtcgccggg
gcaccacaggtcgcgggaattgatctgccgccgctcaatgcggccgaatcacgagcacag
ctcgccctatgggcggaatggggatcgcctctgatcgcgggcaacgacctgacacacatg
cccgaggacatccgtgcgctgctgatcaatcgggatctgcttgccattgatcaagattcg
ctgcgcgcgtccgcgaccgcactggcgggcagcggcggaaccatttggacccggccgctt
ggcgatggatccacggcgatcgtgattgtgaaccgcgacgacgccgcacagcctttccgg
gctgcgttcagcgcgctggggctgcccaaagcccggcggttcgacgtcctcgacgtgttc
tcgggacaacggtcggtgcagccgctgacgtatcgcaccagcctggcggcacacgatgcc
atgctgctgcgagtacgggcgatcggcgaccaataa

DBGET integrated database retrieval system