KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_2428Help
Entry
MYCMA_2428        CDS       T02177                                 

Definition
acetaldehyde dehydrogenase 2 (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MYCMA_2428
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYCMA_2428
   00650 Butanoate metabolism
    MYCMA_2428
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MYCMA_2428
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYCMA_2428
   00622 Xylene degradation
    MYCMA_2428
   00621 Dioxin degradation
    MYCMA_2428
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MYCMA_2428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4459555..4460523
Genome map
AA seq 322 aa AA seqDB search
MTLPSETPKTPVAIIGSGNIGTDLMIKVIRRSRILSMGAMVGIDPTSDGLARAARLGVAT
TADGVEGLIHMEQFAEVAIIFDATSAATHRENAARLAPYDKRLIDLTPAAVGPYVVPPVN
LGAHIASGATNLNMVTCGGQATIPIVHAVSRVAPVVYAEIVASISSRSAGPGTRANIDEF
TETTARAIEQVGGAARGKAIIVLNPADPPPLMRDTVFCLVGDADHGTIRRSVKEMIAEVS
TYVPGYRLKQDVQFDRVDEPMRALLRDTTGTVTTKVSVFLEVEGAGHYLPSYAGNLDIMT
SAALHTAESMVRGGDSSQEFGI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttccgtctgaaactccgaaaacacctgtggccattatcggttcggggaacata
ggtaccgacttgatgatcaaggtgattcggaggtcccggatactgagcatgggtgcgatg
gtgggcatcgaccccacctcggacgggctggcacgcgcggcacgtctcggcgtggccacc
accgccgacggggtagaaggcttgatccacatggaacaattcgcggaggtggcaatcatc
ttcgatgcaacttcggccgcaacacatcgtgagaacgcagcacgattggctccctacgat
aagcgactgatcgacctcactccggccgcagtcgggccatatgtcgtcccgccggtaaac
cttggcgctcacatcgccagtggtgcaacaaatctcaacatggtcacatgcggtgggcag
gcaacaataccgattgtgcatgccgtatcgcgagtagcccccgtagtatacgcggaaatc
gtggcatcgatatcctctcgttctgccggtcccggtacgcgcgccaacatcgatgaattc
accgaaaccacagcccgggccatcgaacaggtaggtggagcggcgcgcggtaaggcgatc
atcgttctgaatcctgccgacccaccaccgcttatgcgtgacaccgtattctgcctagtc
ggtgacgccgaccacggtacgattcggcgctcggtcaaggagatgatcgctgaggtctcc
acctacgttcctggatatcgcctcaaacaagacgtgcagttcgaccgagtcgacgaaccg
atgcgtgctctgcttcgcgacaccaccgggacggtgaccaccaaagtgtcggtgttcctg
gaggtggagggcgccggacactatctacccagctacgccggcaatctcgacatcatgacg
tctgcggccctgcacaccgcggagtcaatggtccgtggcggcgattcatcgcaggagttc
ggcatatga

DBGET integrated database retrieval system