KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_2477Help
Entry
MYCMA_2477        CDS       T02177                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYCMA_2477
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    MYCMA_2477
Enzymes [BR:mmv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MYCMA_2477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451285..452412
Genome map
AA seq 375 aa AA seqDB search
MRAGTVLTGLVVAALTACGGNASEPSKENTSSTKAQAPATAAPAADLACLSTRDRLAQLL
MVGIKDADDARALVRDHHVGGIFVGSWTKKEMLTDGSLHDVITAGPIPAAVSIDEEGGRV
SRLKDLIGPAPSARELAATQTPEQVQALSQERAQKMKDLGITIDFAPDADVTDGDPDGAI
GDRSFSGDPQKVAEYAEAAVRGYQAGGVRAVVKHFPGHGHASGDSHTNGVVTPPLEQLKD
NDLVPYRSLVTSGAAVMIGHMQVPGLTGDDPASLSGAAVDLLRKGTGYGAPAYDGVIFTD
DLSSMAAITDRFPIEEAVLKSIKAGVDWALWVSTEKVGSVLDRLESAYNAGELNADAINA
SVRRVLAYKGVPACG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaggcacagtactgaccggtctcgtcgtcgcggcgcttaccgcttgcggtggc
aatgcctcggagccctcgaaggagaacacgtcgtcgacgaaggcgcaggcgccggcaacc
gctgcgccggccgctgacctggcctgtctgagtactcgcgaccggttggcgcagctactc
atggtcggcatcaaagacgccgacgacgcccgtgcgctggtgcgcgaccatcacgtcggc
ggcatcttcgtcggcagctggaccaagaaggagatgctgacggacggttcgctgcatgac
gtcatcaccgccggccccattccggctgccgtgagtatcgacgaggagggcggccgggtg
tcgcgcctgaaggatctcatcggcccggcgccgtcggcccgtgaattggccgctacccag
acacccgagcaggtgcaggcgctgagccaggagcgtgcccagaagatgaaggacctcggg
atcaccatcgacttcgctccggacgccgatgtgaccgacggtgatcccgacggtgccatc
ggtgaccgttcgttcagcggcgacccccagaaggttgccgaatacgccgaggccgccgtg
cgcggataccaggccggcggggtgcgtgccgtggtcaagcatttccccggacatggtcac
gcctcgggcgattcacacaccaatggggtggtgaccccgccactggagcagctgaaggac
aacgatttggtgccgtaccgctcgctggttaccagcggtgctgcggtgatgatcggccat
atgcaggtgccggggctcactggagacgatccggccagcctcagcggtgcagcagttgac
ctgctgcgcaagggaaccggctacggcgcgccggcctacgacggtgtcatcttcaccgac
gacctgtcctcgatggccgccatcaccgaccgtttcccgatcgaggaagccgtgctcaag
tcgatcaaggcgggcgtcgactgggcgctctgggtaagcaccgagaaggttggttcggtt
ctggatcgtctggaatcggcttacaacgcaggcgaattgaatgccgatgcgatcaacgcg
tcggtgcgccgggtgctggcgtacaagggtgttcccgcctgcggttag

DBGET integrated database retrieval system