KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_2619Help
Entry
MYCMA_2619        CDS       T02177                                 

Gene name
cenA
Definition
endoglucanase A (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCMA_2619 (cenA)
Enzymes [BR:mmv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MYCMA_2619 (cenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4889573..4890529)
Genome map
AA seq 318 aa AA seqDB search
MISSAVGAVARWIAPCLAVLSLGIFLGPVAEADNPLDGQGFYVNPNSAAMRAAQGAGSPE
LTSIANTPQAYWMDNVSSPSVDAKYISAAQASGATPVLALYAIPHRDCGSFAAGGFGSAD
AYKGWIDGVAAAIGAGPAVVILEPDALAMADCLSGAQRQERFDLMRYAVDTLTRNPATAL
YIDGGHSRWVSADVMAARLNEVGVSKARGFSLNTANFFTTDEEIGYGDAISGMTNGAHYV
IDTSRNGAGPTSDALYWCNPSGRALGTPPTTATASPNADAYLWVKRPGESDGSCDRGDPR
AGTFVNQFAIDLARNAGR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcctcagctgttggtgctgttgcgcgatggattgccccctgtttggccgtgttg
agcctgggtattttcttgggcccggtggcagaggcggacaacccgctggatggccaaggg
ttctacgtcaatcccaactcggcagccatgcgtgccgcacagggcgcgggcagccccgag
ctgacgtccatcgccaatacaccacaggcgtattggatggacaacgtctcatccccgagc
gtggatgcgaagtacatcagcgcggcccaggcctccggtgccacacccgtgttggctctc
tacgccattcctcaccgcgactgcggcagcttcgccgccgggggcttcggatcggccgac
gcatataaaggatggatcgacggtgtggccgccgccatcggggccgggcccgcggtggtc
attctcgagcccgacgcgctcgcgatggctgattgcctctcgggggcccagcgccaagag
cgctttgatctgatgcgttatgccgtcgacacactgacccggaatccggccaccgccctc
tacatcgacggtggccactcacgttgggtgagcgccgatgtcatggccgcccggctcaat
gaggtaggcgtcagcaaggcgcggggctttagcctcaacaccgcgaacttcttcaccacc
gacgaggagatcggttacggcgatgcgatttcggggatgacgaacggtgcgcattacgtg
atcgatacctcgcgcaatggcgccggccccacttccgatgcgctctattggtgcaacccg
agtggtcgtgcgctcggtaccccgcccaccaccgccaccgcgagtccgaatgccgatgcc
tacctgtgggttaagcgtcccggtgagtccgacggctcgtgcgaccgtggagacccgagg
gcaggcaccttcgtgaatcagttcgcgatcgatctggcgcgtaacgcaggccggtag

DBGET integrated database retrieval system