KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_2660Help
Entry
MYCMA_2660        CDS       T02177                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00010  Glycolysis / Gluconeogenesis
mmv00020  Citrate cycle (TCA cycle)
mmv00620  Pyruvate metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
mmv01130  Biosynthesis of antibiotics
mmv01200  Carbon metabolism
Module
mmv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCMA_2660
   00020 Citrate cycle (TCA cycle)
    MYCMA_2660
   00620 Pyruvate metabolism
    MYCMA_2660
Enzymes [BR:mmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MYCMA_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFN64787
Position
42471..43778
Genome map
AA seq 435 aa AA seqDB search
MAVKQFLLPDLGEGLTEADLISWKVRVGDEVKLNQVLADVETAKAMVELPSPFEGTVVAL
QAAENSTVAVGAPLISIEVAAAEPDTPANLVGYGPSESVGQTRRRRRSGAGAAALALVEQ
TTEPEPAVAAPAAQAEAVPPRAAAKPSVRKLAAELGVALELINGTGIGGSITRQDVEAYT
RSLTARAPQGALAGEEPVAGVAVQPGGETRIPIAGVRKHTAAAMVRSAFTAPHVTEFLTV
DMTSTMGLLAELRAKSPDLKLTPMTLVARMVLLALRSHPSLNSTWDEQAGEIIVKHHVNL
GIAAATERGLVVPNVKGADAMSLGELATAIARLVSTARDGKTAPADMSGGTFTLTNIGVF
GVDAGTPIINPGEAAILALGSVAKRPWVVNGELAVRDVTTLALSFDHRLVDGEQGSKFLA
DLGAMLTDPRMALVV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaacagtttctgcttccagacctcggagaagggcttaccgaggcggatctg
atttcctggaaggtgcgggtcggcgacgaggtgaagctcaaccaggtgcttgccgacgtg
gagaccgcgaaggcgatggtcgaattgccgtcgcccttcgagggcacggtggtggcccta
caggcagccgagaattcgactgttgcggtgggcgcgccgctcatctcgatcgaggtggcc
gctgccgagcccgacacgcccgccaatcttgtgggatacggcccgtcggagtcggtgggc
cagacgcggcgccggcgacgctcgggagcaggtgcggccgcactggcactcgtagaacag
acaaccgagccagagcccgccgtcgccgcgccggcagcccaggcagaggcggtaccgccg
cgcgcggcagctaagccgtccgtccgcaagcttgccgccgaactgggcgtggccctcgaa
ctgatcaacggaacaggtatcggcggcagtatcacgcgccaggatgtggaggcatacacc
cgtagcctcaccgctcgtgcgccgcagggcgcgctcgcgggggaggagccggttgccggt
gtcgcggtccagccgggcggtgagacgcggattccgattgcgggagtgcgcaagcacacc
gccgccgccatggtgcgcagcgcgttcaccgcaccgcacgtcaccgagttcctcaccgtc
gacatgacctcgacgatggggctgctggccgaactgagggcgaagtctcccgatctcaag
ctcaccccgatgacgttggttgcccggatggtgttgctggcgctgcggtcgcatccctcg
ctgaactccacctgggatgagcaggccggggagatcatcgtgaaacaccacgtgaatctg
ggcatcgcggcagccacggagcggggattggtggtgccgaacgtcaagggagccgacgcg
atgtcgctgggtgaattggctactgctatcgcacggttggtgtccaccgcgcgcgatggg
aagaccgcgccggccgatatgagtgggggcacattcaccctcaccaacatcggggtcttc
ggtgtcgacgccgggacaccgatcatcaacccaggggaggcggcgatcctggcactgggc
tccgtcgccaagcgtccctgggtggtgaacggcgagctggcggtgcgggacgtcaccaca
ctggcgttgtcgttcgaccaccgactggtggacggtgaacagggatcgaagtttctcgcc
gatctgggggcgatgctcaccgatccacgaatggcactggtggtgtag

DBGET integrated database retrieval system