KEGG   Marinomonas sp. MWYL1: Mmwyl1_0409Help
Entry
Mmwyl1_0409       CDS       T00567                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mmw  Marinomonas sp. MWYL1
Brite
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mmwyl1_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
469933..471042
Genome map
AA seq 369 aa AA seqDB search
MRVKCAYLSSLVGHLALGSILLVCTPYLYAGDYIWALPAWMPAPIVPVDNPMSEEKVTLG
QRLFYDANLSGPGYMSCSTCHMPEHSFSEPRPVSVGVTGQFHSRNAMSIVNVAYMKTLTW
ANPNEVRLEDQANVPIFGTHPIEMDTKGQEEKVILFLQRDPIYPNLFHKAFPDQDNPISF
DTITKALASFERTLISYQSPYDDYKYNHNDSAISEDAKLGEALFFSARLGCSSCHTSVHF
SDATQTPAFHNTGLYNLDGKGAYPEGNQGLFEHTGKEADKGRFRTPTLRNIAQTAPYMHD
GSIATLEEVIEHYAAGGRAAQQGKASPLRSDKLHPFVLTDDEKRQLMAFLTSLTDSKFID
NPHFTTPFR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcaaatgtgcttatctttcatccctcgttgggcatcttgctttggggtcaata
ttgctagtttgtactccctacctatatgcaggtgattatatttgggcattgcctgcatgg
atgcctgcacctatcgtgcctgtagataatccaatgagcgaggaaaaagtcacgttaggt
cagcggcttttttacgatgccaatttgtctggtccaggttacatgtcctgttcgacctgt
catatgcctgaacattcattttcagagccaagacccgtttctgtcggtgtcacagggcag
tttcatagtcgtaatgccatgtcgattgtcaatgtggcttatatgaaaacactgacttgg
gcgaatcctaacgaggttcgtttagaagaccaagcaaatgtgcctattttcggtactcat
cccattgaaatggacaccaaagggcaagaagaaaaagtaattttgtttctacaacgggac
cctatttatccaaatttatttcataaagcctttcctgatcaagacaaccctattagcttt
gacacgattaccaaagcgctggcttcttttgaacgtactttaattagttatcagtcacct
tatgacgattacaaatacaatcataatgacagtgccatcagcgaggatgctaagcttggt
gaggcattattttttagtgcgagattggggtgttctagctgtcatactagtgtgcatttt
tccgatgcgacgcaaacaccagccttccataacacagggctttataacttagatggtaaa
ggtgcttacccagaaggcaaccaaggattgtttgaacatacagggaaagaggcagacaaa
ggacgatttagaacaccaacgctgcgcaatatcgctcaaacagcgccttatatgcatgat
ggctctatcgcgaccttagaagaggtgatagagcattatgcggctggtggacgtgcagca
cagcaaggtaaagcgtctccattaaggtctgataagttacatccgtttgtattaaccgac
gatgaaaagcgtcaacttatggcgtttttaacgagtcttacggacagcaaattcatagac
aatccgcactttacgaccccatttagatag

DBGET integrated database retrieval system