KEGG   Marinomonas sp. MWYL1: Mmwyl1_0617Help
Entry
Mmwyl1_0617       CDS       T00567                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmw00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
676935..677855
Genome map
AA seq 306 aa AA seqDB search
MNGRLMQELEELGGEIRPASLRKCDEIVIEQPGFSAVIALWGGHLESFIPAGQEDLLFQS
INPGGEGRFGRRHFGVPVCWPWFGANETHADFPAHGLARYFRWELIEAGRFKNGDVKIVI
RLASEDHPLIEEMWPFAFELRQVFRFSNKGFRVNFSAANLSDKPMLISEALHTYFNISDN
QTAEVHGLDQVSYVDKFDNGSQKLQQGAVTPCDHMDRVYTSAPEKCEILDTGLQRRLVIS
TEGSNSTVLWNPGAEIAKQRTDMEDDDYRRFVCVEAGNALGDAYSIPVGGIHQLKLKVKS
KPLVDE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatggccgactgatgcaagagttggaagaattgggtggtgaaatacgcccagcaagc
ttaagaaagtgcgacgagatcgtcattgagcaaccaggctttagtgcggtcattgcctta
tggggcgggcatttggagagcttcattcctgcgggtcaagaagatctgttatttcaatcg
ataaatccaggtggtgaaggccgttttgggcgtcgtcattttggtgttcctgtttgttgg
ccttggtttggtgctaacgaaacgcatgcggatttccctgcgcatggtctggctcgttat
tttcgttgggaattaattgaggcggggcgttttaaaaatggtgatgtaaaaatcgttatt
cgtctggcttcggaagatcaccctttgatcgaagaaatgtggccatttgcttttgagtta
cgacaagtctttcgtttctcaaataagggctttagagtgaatttctctgcggcgaatcta
tccgataagccgatgctaattagcgaagctttgcacacctattttaatatctcagataac
caaacggctgaagtacatggcttagaccaagtaagttatgttgataagtttgataatggc
agtcagaagttgcaacaaggtgctgtgacaccatgtgatcatatggacagggtgtatact
tctgcaccagaaaaatgtgaaatcctagatactgggttgcaaagaagattagtgattagc
acagaaggtagtaacagtactgtgttgtggaacccaggtgcagaaattgctaagcagcgc
actgatatggaagacgatgactatcgtcgttttgtctgtgtcgaagcgggtaacgcgctt
ggtgatgcttatagcattccagtcggtggaattcatcagcttaagctaaaagtgaagagc
aagcctctggtggacgaatag

DBGET integrated database retrieval system