KEGG   Marinomonas sp. MWYL1: Mmwyl1_0740Help
Entry
Mmwyl1_0740       CDS       T00567                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mmwyl1_0740
   00500 Starch and sucrose metabolism
    Mmwyl1_0740
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Mmwyl1_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(803312..805909)
Genome map
AA seq 865 aa AA seqDB search
MKHSVAIGLVTAVGALLSFQSHAVGLYQAVVSSNPKAGEYSSIKDALQNAPEDKSTYSVY
IKPGLYNEQITIDRDNVHLIGAGRDKTIIAKAIAAGMKGDNGKNIGTSGSRVVEINGKDF
SAQSLTIRNDFDYLTNDSKAKDDPNKINQTQAVALLLGKKSDRSAFYDVSLEGFQDTFYS
KGGRSYFNNSRISGTVDFIFGNGLVIFDNSDIVARYRPNQELPLGYLTAPSTNDKQAFGL
VFINSRLIKEDNRIPAASYALGRPWHPTTTFQDGRYADPFAIGSTTFINTQMDDHIYGWD
KMHGKDINGESIWFTPENGARFSEYKSYGSGASKEGYRPQLSDNEVTKFTIENMLDGWQP
IFLAAQNTTIKGIVSAHLMKFPAQITLSDQYGRKASTTTDRHGAYQLKIKGFIPPFVVSA
AEQNTDCLSNNTLRGICMAALYAPTKLQLEQNINININPFSDLILSDTATASGYLGPQQV
VSSPKLPLAFSAIEYALSVARFHQGFDNSLNDLGLPKHFDPVQYQPQWQPAFAQLTQWLW
SNRNYQTKVGEVADSTLMDRFFQPLLVPDLQGKVAAFDLSAIEKKQQQVDTALHRIFIIG
DSTASNYPQVVAPRMGWGQTFQENFDTQKVQVINGAQSGRSSRSYYNQGWFRYLSSMMHS
GDYLLIQFGHNDEKCDASSAGRGPHDVANTCTYPNNADGQIQAPAGQESFSFQRSLEFFI
DYAKSHQITPVLLTPVTRMKTLKGKNEFRVVSTHFTKQNSTKAFTFTGNYSQTIKDTAQA
NNTVLLDIEARTIELANTLGKDKWKDYWLAVDPQKYPYYKDRSGRLDKPDATHFQEKGAK
AVAQLIAEEVHNTPELKELSGALDH
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactctgttgcgataggcttagttaccgctgttggcgcgctactgtcatttcaa
tctcatgcagtcggtttgtaccaagctgtcgtatcatccaaccccaaagctggagagtac
agcagcattaaagatgctctccaaaatgcaccagaagataaaagtacttacagcgtatat
atcaaaccaggcctctataacgaacaaatcacaattgaccgtgataatgtgcaccttatt
ggtgcgggacgagataaaactatcattgccaaagctattgctgcaggcatgaaaggtgat
aatggcaagaacattggcacttcaggcagtcgagtggttgaaatcaacggtaaagacttc
agtgctcagtctcttaccattcgtaacgactttgactatctgactaatgacagcaaagca
aaagacgatccgaataaaatcaatcaaactcaagccgtcgctttattacttggtaaaaaa
agcgaccgttcagcattctatgacgtatctctagaaggtttccaagataccttttacagc
aaaggcggtcgaagctacttcaataactcccgtatcagcggcactgttgattttattttc
ggaaacggtttagttatttttgataatagcgatattgtcgctcgttaccgtccaaaccaa
gaactccctttaggctatttaacagccccaagcaccaatgataaacaagcctttggttta
gtattcatcaatagccgcttaataaaagaagacaaccgcattccagcagctagttacgcc
cttggccgcccttggcacccaactactacttttcaagatggccgttatgccgatcccttt
gccataggttcaaccacttttatcaatacacaaatggatgatcacatctatggctgggat
aaaatgcacggtaaagatataaatggagaatctatttggtttacaccagaaaatggtgca
cgtttcagtgaatacaagagctacggatctggcgcctcaaaagagggttatcgccctcaa
ttaagcgataacgaagtcactaaatttactatcgaaaacatgcttgatggctggcagccg
atttttctggccgcccaaaacacgactatcaaaggcattgtaagcgcccatctaatgaaa
tttcccgcccaaataactttgagcgaccaatacggtagaaaagcatcaaccactacagat
agacatggagcttatcaacttaaaataaaaggcttcatcccacctttcgtcgtctccgca
gctgaacagaacactgattgtttaagcaataacacattacgcggaatatgcatggctgcc
ctctatgctccgaccaagctacaactcgagcaaaacattaatatcaatattaatccgttt
agtgacctaattttatcggataccgcaacggcatcgggttacttaggtcctcaacaagtt
gtgtcctcaccaaaactaccactcgccttttcggcaatagaatatgctttatctgtggca
cgttttcatcaaggatttgataacagcttaaatgatttaggattaccaaaacatttcgac
cccgtgcaatatcaaccacaatggcaacccgcatttgctcagctaacacagtggttatgg
agcaatagaaattatcagaccaaggttggtgaagttgctgatagcaccctaatggatcgt
ttttttcagcctctacttgtccctgatttacaaggcaaagtagcagcgtttgaccttagt
gctatagagaaaaaacagcaacaagtcgatacagccctacatagaatatttattattggc
gactcgacagcgtcaaattacccacaagtcgttgcacctcgaatgggctgggggcaaacc
ttccaagagaattttgacactcaaaaagtacaagttattaatggtgcacaatcgggtcgt
agctctcgctcatattataatcaaggctggtttcgctacctcagtagtatgatgcactct
ggagattatttacttattcaatttggtcacaatgacgaaaaatgtgacgcgagcagcgct
ggacgaggccctcacgatgtcgctaacacctgtacctacccgaataatgcggatggtcaa
atacaagccccagctgggcaggaaagtttttcattccagcgctcactggagttttttatt
gactatgccaagtcacatcaaatcacaccggttttattaacgcctgtgactcgaatgaaa
acactaaaaggaaaaaatgaatttcgtgttgtttctactcatttcaccaagcagaacagc
acaaaggcatttacctttactggcaactatagccaaacaattaaagacacagcccaagcc
aacaatacggttttattagatatagaagcacgcaccatagaacttgctaatacactaggg
aaagataagtggaaagattattggctggccgtcgatccacaaaaatacccttattacaaa
gaccgttcaggtcgattagacaaacctgatgccactcattttcaagaaaaaggagcgaaa
gcggttgctcaattgatcgccgaagaagtccataatacacccgagcttaaggagctatca
ggcgcactagatcattaa

DBGET integrated database retrieval system