KEGG   Marinomonas sp. MWYL1: Mmwyl1_0747Help
Entry
Mmwyl1_0747       CDS       T00567                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mmw  Marinomonas sp. MWYL1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(810573..812099)
Genome map
AA seq 508 aa AA seqDB search
MTESSSDKLIEALRKAVSRTSMLAEGNDPELDSVVRQIRQVITKGANAQEIQDVLNNAEP
LLIKSDEAQSSRAKQVRSTLQELIDLLEKQDSKRVPQNEKKELEAQIRLHWQTPSKWPHL
LKGFLALAEKTLTQIESGQPKSSLFRRFFNRDLETKSQKNDQEIMIQISHTLAGLMNNLS
LPSHYDEDIVDLKKALLGNDNLQQLPGLLDEVINLIMIAIGRTQESLTNYLNQLNKQLAS
INESISSSYHSQKSLSVSREGFNNKLQKQVTDTSQAVQSANDLDSLKALINDRLLTISST
MTEYKTQMVEQEKYANQSITLLKNKVTRMEKDTVSLRSLLQEKLAQAMTDSLTDLPNRTA
YQDAILPLCKIMQKTQKSICLAVCDIDHFKKVNDTWGHLAGDKVLRLVPKQIRSALLKED
LMFRYGGEEFVIAFPETTLEQAVERAEAIRLAVAKTPFNMQGEPVSISISIGIAELQAQE
NPESLFARADKQLYMAKEAGRNRVMANK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatcatcgagtgacaaactgatagaagcgttacgtaaagcagtttccagaacc
agtatgctagctgaagggaatgacccagaacttgattccgtcgttcgccaaattcgccaa
gttataaccaaaggggcaaatgcccaagaaatacaagatgtacttaataatgcagaacca
ctgctaatcaaaagtgatgaagctcaaagcagccgagctaaacaggttagaagtacatta
caagaacttatcgatctgcttgaaaaacaggacagtaaaagagttcctcagaacgagaaa
aaagaacttgaagcccaaatacgcctacactggcaaactccatctaaatggcctcacctc
ttaaaaggctttttggcgttggctgagaaaacattgactcaaatagagtctggtcaacct
aaaagctcactttttagacgttttttcaatcgagatctagaaacgaagtcacaaaaaaat
gatcaagaaatcatgattcaaattagccacacacttgctgggctcatgaataacttatca
ttaccgagtcattacgacgaagacattgtcgacttaaaaaaagcacttttaggcaacgac
aatctccaacaacttcctggactgcttgatgaagttatcaacttaatcatgattgccatc
ggcagaacacaagaaagtctgactaactatcttaatcagttaaataagcaacttgccagt
atcaacgaatccatctccagcagctatcactcacagaagtcactatctgtgagtcgcgaa
ggttttaacaacaagctacaaaaacaagtcacagacacatctcaagcagttcagagcgcc
aacgatttagatagcctaaaagcactcattaacgataggctgttgactatttcaagcacc
atgaccgaatacaagacgcaaatggtagagcaggaaaaatacgctaaccaatccatcacc
ttgcttaaaaataaagtaacacgaatggaaaaagataccgtatcgctacgctcgctgcta
caagaaaaactcgctcaagcaatgacagattcattgacagatctaccaaaccgaaccgct
taccaagacgcaattttgcccttgtgcaaaatcatgcaaaaaactcaaaaatcgatttgc
ttagcggtctgcgatatcgaccactttaaaaaagtaaatgatacttgggggcaccttgct
ggtgataaagtattacgcctcgtaccaaagcaaatacgtagtgctctattaaaagaagac
cttatgtttcgttacggtggcgaagaatttgttatcgcgtttccagaaacgactctggaa
caagctgtcgaacgtgctgaagctattcgacttgccgtggccaaaacgccattcaatatg
caaggtgagccagtatcgatttccatatctattggtatcgcagaacttcaagcacaagaa
aacccagaatctttattcgctagagcagacaaacaactctatatggctaaagaagcaggg
cgaaatagagttatggcaaataaatag

DBGET integrated database retrieval system