KEGG   Marinomonas sp. MWYL1: Mmwyl1_1021Help
Entry
Mmwyl1_1021       CDS       T00567                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1138099..1138932
Genome map
AA seq 277 aa AA seqDB search
MSLMPFGDKSLDLSLPHVMGILNVTPDSFSDGGAFNSLDSALRQTEKMIQEGASIIDVGG
ESTRPGALPVSVQQELDRVLPIVAAIKKRFDIVVSVDTSTTEVIEGAARLGMGLINDVRA
LEREGALNAAAQTDLPIGLMHMKGMPQTMQDKPDYASVVDEVSSYLLSRVDACESAGIAR
SRIILDPGIGFGKTLAHNLSLLKHTELFTGMGFDVLIGLSRKTMIGEALGLPVEERLYGT
MGANASAYLKGARIFRVHDVRPHVEMLALMSRIEREI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaatgccttttggggacaagtcgctagacttgtcccttcctcatgtaatgggg
attctaaatgtcacgccagattctttttctgatggtggtgcttttaactctttagatagt
gctttgcgccagactgaaaagatgattcaggaaggagctagcattattgatgtcggtggc
gagtcaactcgcccaggtgctttgcctgtatcggttcagcaagagctagatcgagttttg
ccaattgtagcagccataaaaaaacgttttgatattgtggtgtcggtagatactagtact
accgaggtgattgagggcgccgctcgtctggggatgggcttaatcaatgatgtcagggct
cttgaacgagagggagcgctgaatgctgcggctcaaacggatttgccgattggcctaatg
catatgaaaggtatgccgcagaccatgcaagataagccagattatgcttcggtggttgat
gaagtatcgagttacttattgtctagggttgatgcctgtgagtcggcgggaattgctcgg
tctcgcattattttggatcctggtattgggttcggaaaaacgttggcgcataatttatcc
ttgctgaagcacaccgagctattcactggtatgggctttgatgtccttattggtctttcg
agaaaaactatgattggggaggctttgggtctgcctgttgaagagcgcttatatggcact
atgggggcaaatgcttctgcctatttgaagggggctcgtatttttagggttcatgacgtt
aggccgcatgttgaaatgttggcgctaatgtctcgtattgagagagagatttaa

DBGET integrated database retrieval system