KEGG   Marinomonas sp. MWYL1: Mmwyl1_1023Help
Entry
Mmwyl1_1023       CDS       T00567                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_1023
   01230 Biosynthesis of amino acids
    Mmwyl1_1023
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_1023
   00051 Fructose and mannose metabolism
    Mmwyl1_1023
   00562 Inositol phosphate metabolism
    Mmwyl1_1023
Enzymes [BR:mmw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmwyl1_1023
Exosome [BR:mmw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmwyl1_1023
  Exosomal proteins of bladder cancer cells
   Mmwyl1_1023
  Exosomal proteins of melanoma cells
   Mmwyl1_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1140368..1141117
Genome map
AA seq 249 aa AA seqDB search
MIRQKIVAGNWKMNGSKESIVSLISGLLEMDSSSSEVVVAPSFPYLSQVDGLISASSIVL
AAQNVSQEVKGAFTGEVSTSMLGDFGVKYVLLGHSERRSLYGETNELVASKVKTVLDSGL
TPMLCIGETLAERESGKTLEICEQQLQAVIDLVGIASFEQLVIAYEPVWAIGTGLSASAE
QAQEVHESIRSFLAKSSESVSQKVQILYGGSVKASTSSALFQMPDVDGALVGGASLDAKE
FIAIVKTAG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtcagaaaatagtggctggtaactggaaaatgaatggctcgaaagagtctatt
gtttcactgattagcggtttgcttgagatggacagttctagctctgaagtggttgttgct
ccatcttttccctatttgtcgcaagttgatggtttgatatctgctagtagcatagtttta
gctgcacagaatgttagccaggaagtaaagggcgcctttacaggtgaagtgtctacttct
atgttgggtgactttggggttaagtatgtgttgcttggtcattcagagagacgttctctt
tatggtgaaacaaatgagcttgtcgcttctaaagtgaaaactgttttagattctggttta
accccgatgctctgtatcggtgaaacattggcggaacgagagtcaggtaaaacactagag
atttgcgaacagcaacttcaagctgtcattgatcttgtggggattgcctcttttgagcag
ttggttattgcttatgagccggtgtgggcaataggaacaggcttgtcagctagtgcagaa
caggcacaagaagttcatgaatctattcggtcttttttagctaaatcatctgagtctgtt
tctcaaaaagttcagattttgtatggtggaagtgttaaagcatcaacgagctcggctttg
tttcaaatgcctgatgtagatggtgctcttgttggtggtgcatctcttgatgcaaaagaa
tttatcgcgattgtaaaaacagcaggttaa

DBGET integrated database retrieval system