KEGG   Marinomonas sp. MWYL1: Mmwyl1_1023Help
Entry
Mmwyl1_1023       CDS       T00567                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mmw01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmw01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmw00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmw00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mmw00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1140368..1141117
Genome map
AA seq 249 aa AA seqDB search
MIRQKIVAGNWKMNGSKESIVSLISGLLEMDSSSSEVVVAPSFPYLSQVDGLISASSIVL
AAQNVSQEVKGAFTGEVSTSMLGDFGVKYVLLGHSERRSLYGETNELVASKVKTVLDSGL
TPMLCIGETLAERESGKTLEICEQQLQAVIDLVGIASFEQLVIAYEPVWAIGTGLSASAE
QAQEVHESIRSFLAKSSESVSQKVQILYGGSVKASTSSALFQMPDVDGALVGGASLDAKE
FIAIVKTAG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtcagaaaatagtggctggtaactggaaaatgaatggctcgaaagagtctatt
gtttcactgattagcggtttgcttgagatggacagttctagctctgaagtggttgttgct
ccatcttttccctatttgtcgcaagttgatggtttgatatctgctagtagcatagtttta
gctgcacagaatgttagccaggaagtaaagggcgcctttacaggtgaagtgtctacttct
atgttgggtgactttggggttaagtatgtgttgcttggtcattcagagagacgttctctt
tatggtgaaacaaatgagcttgtcgcttctaaagtgaaaactgttttagattctggttta
accccgatgctctgtatcggtgaaacattggcggaacgagagtcaggtaaaacactagag
atttgcgaacagcaacttcaagctgtcattgatcttgtggggattgcctcttttgagcag
ttggttattgcttatgagccggtgtgggcaataggaacaggcttgtcagctagtgcagaa
caggcacaagaagttcatgaatctattcggtcttttttagctaaatcatctgagtctgtt
tctcaaaaagttcagattttgtatggtggaagtgttaaagcatcaacgagctcggctttg
tttcaaatgcctgatgtagatggtgctcttgttggtggtgcatctcttgatgcaaaagaa
tttatcgcgattgtaaaaacagcaggttaa

DBGET integrated database retrieval system