KEGG   Marinomonas sp. MWYL1: Mmwyl1_1037Help
Entry
Mmwyl1_1037       CDS       T00567                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_1037
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_1037
   00052 Galactose metabolism
    Mmwyl1_1037
   00500 Starch and sucrose metabolism
    Mmwyl1_1037
   00520 Amino sugar and nucleotide sugar metabolism
    Mmwyl1_1037
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mmwyl1_1037
   00524 Butirosin and neomycin biosynthesis
    Mmwyl1_1037
Enzymes [BR:mmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mmwyl1_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1154585..1155559
Genome map
AA seq 324 aa AA seqDB search
MSHALIADLGGTNARFALVPIHQYEPLEVRVLPCKNYDNFFDAAADYIENCSISMDKIDA
IVLAIAGPVNQPVIQFSNNPWKFTRDEVQSYFGDNKPVALLNDFDAVGHCLEILKPEDVV
VIGESSAVDPKGACWVVGAGTGLGISCVVPQDNGPNIVLPGEGGHVDLSSCNEVEDDILK
FLRTRHKRVSAERVLSGMGLENIYEALALREGIEKRLTAPEIGEALKLGNDPIATATLEQ
FFVFLGRVIGDLVLSVESRGGVYIAGGIVPRYLKDILKSGFRDAMQDKGRMKEFVSPIPT
FVVMSEYPGLMGCACYASHLVSKA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatgctttaatcgccgatcttggtggaactaatgcgcgttttgctttggttcct
atccatcaatacgagcctctagaagttagagtgcttccttgtaagaattacgataatttt
tttgatgccgcagcggactatatcgaaaactgcagtattagtatggataaaatagatgct
attgttttggcgattgcaggtcctgttaatcagccagtgatacagttttctaataatccg
tggaagtttactcgtgatgaagtgcagtcttattttggtgataataaacctgttgcatta
ctgaacgattttgatgccgttggacattgtttggaaatccttaaacctgaagatgttgtt
gtcattggggaaagttcagctgttgatccaaaaggtgcttgttgggttgttggggctgga
actggcttggggatatcttgtgttgtgcctcaagataatgggcccaatattgttttgcct
ggagaaggcggccatgttgatctatcttcctgtaatgaagtggaagacgacatattgaag
ttccttcgtacacgacataaacgagtttctgcagagcgtgttttatctggtatgggactt
gaaaatatatacgaagcactagcattgcgagaagggattgaaaagcgtttaaccgcacct
gaaattggcgaagctctaaagcttggtaatgatcctattgcaacagctacactggagcag
ttctttgtgtttttgggtcgagtaatcggtgatcttgttttgtcggttgagtctcgcggt
ggtgtatatattgccggtggtatcgttcctcgttatttaaaagatattctaaaaagtggt
ttccgtgatgcgatgcaagacaaaggtcgtatgaaagaatttgtttcccctattccgact
tttgttgtgatgtctgaatacccagggctgatgggctgtgcatgttacgcgtcccatctt
gtgtcgaaagcctag

DBGET integrated database retrieval system