KEGG   Marinomonas sp. MWYL1: Mmwyl1_1063Help
Entry
Mmwyl1_1063       CDS       T00567                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmwyl1_1063
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmwyl1_1063
Enzymes [BR:mmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mmwyl1_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1182287..1183102
Genome map
AA seq 271 aa AA seqDB search
MQIETPTILKKIVARKYEEIAERQSHTPYGNLEVAASVANVHNAPRGFANALKHQIAIGK
SGVIAEIKQASPSKGIIRNPFVPADIARSYERSGAACLSVLTDSDFFKGHEDYLVEARSA
CKLPVIRKDFIVDEYQVLEARAIGADCILLIAACLSGDKLRELDQMARDLGMDVLVEVHN
RPELELALEYTQTELLGINNRDLHTFELSLDHTFELMGSVPSDRLIVTESGIHTRDDVAL
MRQKGIHAFLVGEAFMVADDPGEKLAELFQS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatagaaacaccaacaattttaaagaagattgtagctcgaaagtatgaagaaatc
gccgagcgccaatctcatacgccttatggaaatttagaggtcgcagcgtctgtagctaat
gttcataatgccccgcgcggtttcgctaatgcattaaagcatcaaatagctatcggtaaa
tcgggggttattgctgagattaagcaagcttctcctagtaaaggaattatacgaaacccg
tttgttcctgcggatattgcccgttcatatgagagatctggtgccgcttgtttgtcggtt
ttaacggacagtgatttctttaaaggtcatgaagattatctggttgaagcacgctcggct
tgtaagttgccagtgattcgcaaggatttcattgttgatgagtatcaggtgctagaggct
agagcgattggcgcagattgtattttattgattgcagcgtgtctaagtggcgataaattg
cgtgagttggatcaaatggctcgtgatcttggtatggatgtgctggtagaagttcataac
cgcccagagttagagttggctttggagtatacccagactgaattgcttgggattaacaat
cgagatcttcatacctttgagcttagtttagaccatacgtttgaattgatgggtagtgtg
ccctcagatcgcttgattgttactgagagtggaattcatacgcgtgatgatgtcgctttg
atgcgacagaaaggtattcatgcgtttttggttggggaggcatttatggttgctgatgat
ccaggtgaaaaattggctgagctgtttcagtcgtag

DBGET integrated database retrieval system