KEGG   Marinomonas sp. MWYL1: Mmwyl1_1063Help
Entry
Mmwyl1_1063       CDS       T00567                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01130  Biosynthesis of antibiotics
mmw01230  Biosynthesis of amino acids
Module
mmw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmwyl1_1063
Enzymes [BR:mmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mmwyl1_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABR69994
JGI: Mmwyl11063
UniProt: A6VU65
Position
1182287..1183102
Genome map
AA seq 271 aa AA seqDB search
MQIETPTILKKIVARKYEEIAERQSHTPYGNLEVAASVANVHNAPRGFANALKHQIAIGK
SGVIAEIKQASPSKGIIRNPFVPADIARSYERSGAACLSVLTDSDFFKGHEDYLVEARSA
CKLPVIRKDFIVDEYQVLEARAIGADCILLIAACLSGDKLRELDQMARDLGMDVLVEVHN
RPELELALEYTQTELLGINNRDLHTFELSLDHTFELMGSVPSDRLIVTESGIHTRDDVAL
MRQKGIHAFLVGEAFMVADDPGEKLAELFQS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatagaaacaccaacaattttaaagaagattgtagctcgaaagtatgaagaaatc
gccgagcgccaatctcatacgccttatggaaatttagaggtcgcagcgtctgtagctaat
gttcataatgccccgcgcggtttcgctaatgcattaaagcatcaaatagctatcggtaaa
tcgggggttattgctgagattaagcaagcttctcctagtaaaggaattatacgaaacccg
tttgttcctgcggatattgcccgttcatatgagagatctggtgccgcttgtttgtcggtt
ttaacggacagtgatttctttaaaggtcatgaagattatctggttgaagcacgctcggct
tgtaagttgccagtgattcgcaaggatttcattgttgatgagtatcaggtgctagaggct
agagcgattggcgcagattgtattttattgattgcagcgtgtctaagtggcgataaattg
cgtgagttggatcaaatggctcgtgatcttggtatggatgtgctggtagaagttcataac
cgcccagagttagagttggctttggagtatacccagactgaattgcttgggattaacaat
cgagatcttcatacctttgagcttagtttagaccatacgtttgaattgatgggtagtgtg
ccctcagatcgcttgattgttactgagagtggaattcatacgcgtgatgatgtcgctttg
atgcgacagaaaggtattcatgcgtttttggttggggaggcatttatggttgctgatgat
ccaggtgaaaaattggctgagctgtttcagtcgtag

DBGET integrated database retrieval system