KEGG   Marinomonas sp. MWYL1: Mmwyl1_1180Help
Entry
Mmwyl1_1180       CDS       T00567                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_1180
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mmwyl1_1180
Enzymes [BR:mmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mmwyl1_1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1314959..1316563
Genome map
AA seq 534 aa AA seqDB search
MMHTYKNKTQQASQTIHSQGPTWAAMNPESVVRMQLQNRFNTGLDIAKYTAKIMREDMAN
YDKDPANYTQSLGCWHGFIGQQKMISIKKHFGSTRSRYLYLSGWMVAAMRSEFGPLPDQS
MHEKTSVPALIEELYTFLKQADARELQHLFKEMDEARAAGDQVREQAAQQKVDNFETHVV
PIIADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAK
INAVRYAFLELGVDDGVIVARTDSLGAGLTQKIPVSQTAGDLAEQYNAFIDGEEVTSLEQ
MKSGDMAIKLGERLIKPTRLANGLVRFKSNTGEDRVVLDCITSLQNGADLLWIETEKPHI
GQIASLVNRIREVMPNAKLVYNNSPSFNWTLNFRQQVFDAWMEEGKDVSQYDRDKLMSQD
YDGSALSEEADERIRSFQKDAAAQAGIFHHLITLPTYHTAALSTDNLAKDYFGELGMLGY
VREVQRKEIRQGLACVKHQDMSGSNIGDDHKEYFSGEQALKASGKDNTMNQFAV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatacttacaaaaataaaacgcaacaagctagccagacgatccattcacaaggt
ccaacttgggcagcgatgaacccagaatctgtggttagaatgcaattgcaaaaccgtttt
aatacagggctagatatcgcaaaatacacagctaagatcatgcgcgaagacatggcgaac
tatgacaaagacccagcgaattacactcagtctttaggttgctggcatggttttatcggc
caacaaaaaatgatttctatcaagaaacattttggttcaacacgtagccgttacttgtac
ttgtctggttggatggtggcggccatgcgttctgaatttggtccattgccagaccagtct
atgcatgagaaaacctccgtgccagctcttatagaagaactttataccttcttaaaacaa
gcggatgcccgtgagttgcagcatcttttcaaagaaatggatgaagcgagagccgctgga
gatcaagtgcgtgagcaagcggcacagcaaaaagtggataactttgaaacccacgttgtg
ccgattattgccgatattgacgcgggctttggtaatgaagaagcaacctacttgttagcg
aaaaaaatgatcgaagcgggggcttgctgtattcaaattgaaaaccaagtatcagatgct
aaacaatgtggtcaccaagatggcaaggtaaccgtgccgcatgaagacttcctagcgaaa
attaatgctgtacgttacgcctttttagaattgggtgtagatgatggtgtgatcgtagcg
cgtacagattctttgggtgcgggtttaacgcaaaagatcccagtatcacaaacggctggc
gacttggcggaacaatacaatgcctttattgatggcgaagaagtgacgtcactggagcaa
atgaagtctggtgatatggcgatcaaactgggtgagcgtttgattaagccaactcgttta
gccaatggtttggtgcgctttaagtcgaatacaggtgaagatcgtgtggtgctggattgt
attacgtctttgcaaaatggcgcggatctattgtggatcgaaacggaaaaaccgcatatt
ggtcaaatagcttccttggtgaatcgtattcgtgaggttatgccaaatgctaagcttgtg
tataacaatagtccgtctttcaactggacattgaacttccgtcagcaagtgtttgatgct
tggatggaagaaggcaaagacgtgagtcaatatgaccgcgacaagctgatgtctcaagat
tacgacggtagcgcattgtcagaggaagcggatgagcgtattcgtagtttccagaaagac
gcggcggctcaagcgggtattttccaccatttgattaccttgccgacgtaccatacagct
gccttgtctacggataatttagcgaaagactacttcggtgaacttggcatgttgggctac
gtgagagaggtacagcgtaaagaaattcgccaaggcctggcttgtgtgaagcatcaggac
atgtctggatcaaacattggtgatgatcataaagaatacttctctggtgagcaggccctt
aaagcctctggtaaagacaatactatgaatcaatttgcggtctga

DBGET integrated database retrieval system