KEGG   Marinomonas sp. MWYL1: Mmwyl1_1180Help
Entry
Mmwyl1_1180       CDS       T00567                                 

Definition
(GenBank) isocitrate lyase and phosphorylmutase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00630  Glyoxylate and dicarboxylate metabolism
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mmwyl1_1180
Enzymes [BR:mmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mmwyl1_1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABR70109
JGI: Mmwyl11180
UniProt: A6VUI0
Position
1314959..1316563
Genome map
AA seq 534 aa AA seqDB search
MMHTYKNKTQQASQTIHSQGPTWAAMNPESVVRMQLQNRFNTGLDIAKYTAKIMREDMAN
YDKDPANYTQSLGCWHGFIGQQKMISIKKHFGSTRSRYLYLSGWMVAAMRSEFGPLPDQS
MHEKTSVPALIEELYTFLKQADARELQHLFKEMDEARAAGDQVREQAAQQKVDNFETHVV
PIIADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAK
INAVRYAFLELGVDDGVIVARTDSLGAGLTQKIPVSQTAGDLAEQYNAFIDGEEVTSLEQ
MKSGDMAIKLGERLIKPTRLANGLVRFKSNTGEDRVVLDCITSLQNGADLLWIETEKPHI
GQIASLVNRIREVMPNAKLVYNNSPSFNWTLNFRQQVFDAWMEEGKDVSQYDRDKLMSQD
YDGSALSEEADERIRSFQKDAAAQAGIFHHLITLPTYHTAALSTDNLAKDYFGELGMLGY
VREVQRKEIRQGLACVKHQDMSGSNIGDDHKEYFSGEQALKASGKDNTMNQFAV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatacttacaaaaataaaacgcaacaagctagccagacgatccattcacaaggt
ccaacttgggcagcgatgaacccagaatctgtggttagaatgcaattgcaaaaccgtttt
aatacagggctagatatcgcaaaatacacagctaagatcatgcgcgaagacatggcgaac
tatgacaaagacccagcgaattacactcagtctttaggttgctggcatggttttatcggc
caacaaaaaatgatttctatcaagaaacattttggttcaacacgtagccgttacttgtac
ttgtctggttggatggtggcggccatgcgttctgaatttggtccattgccagaccagtct
atgcatgagaaaacctccgtgccagctcttatagaagaactttataccttcttaaaacaa
gcggatgcccgtgagttgcagcatcttttcaaagaaatggatgaagcgagagccgctgga
gatcaagtgcgtgagcaagcggcacagcaaaaagtggataactttgaaacccacgttgtg
ccgattattgccgatattgacgcgggctttggtaatgaagaagcaacctacttgttagcg
aaaaaaatgatcgaagcgggggcttgctgtattcaaattgaaaaccaagtatcagatgct
aaacaatgtggtcaccaagatggcaaggtaaccgtgccgcatgaagacttcctagcgaaa
attaatgctgtacgttacgcctttttagaattgggtgtagatgatggtgtgatcgtagcg
cgtacagattctttgggtgcgggtttaacgcaaaagatcccagtatcacaaacggctggc
gacttggcggaacaatacaatgcctttattgatggcgaagaagtgacgtcactggagcaa
atgaagtctggtgatatggcgatcaaactgggtgagcgtttgattaagccaactcgttta
gccaatggtttggtgcgctttaagtcgaatacaggtgaagatcgtgtggtgctggattgt
attacgtctttgcaaaatggcgcggatctattgtggatcgaaacggaaaaaccgcatatt
ggtcaaatagcttccttggtgaatcgtattcgtgaggttatgccaaatgctaagcttgtg
tataacaatagtccgtctttcaactggacattgaacttccgtcagcaagtgtttgatgct
tggatggaagaaggcaaagacgtgagtcaatatgaccgcgacaagctgatgtctcaagat
tacgacggtagcgcattgtcagaggaagcggatgagcgtattcgtagtttccagaaagac
gcggcggctcaagcgggtattttccaccatttgattaccttgccgacgtaccatacagct
gccttgtctacggataatttagcgaaagactacttcggtgaacttggcatgttgggctac
gtgagagaggtacagcgtaaagaaattcgccaaggcctggcttgtgtgaagcatcaggac
atgtctggatcaaacattggtgatgatcataaagaatacttctctggtgagcaggccctt
aaagcctctggtaaagacaatactatgaatcaatttgcggtctga

DBGET integrated database retrieval system