KEGG   Marinomonas sp. MWYL1: Mmwyl1_1299Help
Entry
Mmwyl1_1299       CDS       T00567                                 

Definition
(GenBank) Phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00010  Glycolysis / Gluconeogenesis
mmw00680  Methane metabolism
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
mmw01200  Carbon metabolism
mmw01230  Biosynthesis of amino acids
mmw03018  RNA degradation
Module
mmw_M00002  Glycolysis, core module involving three-carbon compounds
mmw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
mmw_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_1299
  Energy metabolism
   00680 Methane metabolism
    Mmwyl1_1299
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mmwyl1_1299
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Mmwyl1_1299
Messenger RNA biogenesis [BR:mmw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mmwyl1_1299
Exosome [BR:mmw04147]
 Exosomal proteins
  Proteins found in most exosomes
   Mmwyl1_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MAAL_C MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: ABR70228
JGI: Mmwyl11299
UniProt: A6VUU9
Position
1454099..1455400
Genome map
AA seq 433 aa AA seqDB search
MSQIVDIKAREVLDSRGNPTVEADVILADGSVGSACAPSGASTGSREALELRDGDKSRYL
GKGVLKAVAAVNGPIRDALIGKDALAQAEIDHIMIDLDGTENKSTFGANAILAVSLAVAK
AAAISKKVPLYAHIADINGTPGVYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAPNFR
EALRYGAEIFHALKKVLSDRGLSTAVGDEGGFAPDLSSNAEALAVIKEAVAAAGYELGKD
ITLAMDCAASEFYDKEANIYDLKGEGKKFTSEEFNFFLQDLTKQYPIVSIEDGLDESDWD
GFAHQTKLMGDKIQLVGDDLFVTNTKILQRGIDNGIANSILIKFNQIGSLTETLAAIKMA
KDAGFTAVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEEQLGGK
APYKGRSEIKGQA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatcgttgatattaaagccagagaagttttagattctcgtggtaatcctact
gttgaagccgatgttattttggcagatggctccgtaggttcagcgtgtgcaccgtctggt
gcctctaccggttctcgtgaagctttagaattgcgtgatggcgacaaaagtcgttatcta
ggcaaaggcgtattaaaagcagttgctgcggttaatggcccaatccgtgacgcattgatt
ggcaaagatgcccttgctcaagctgaaattgatcatattatgattgatcttgatggtaca
gaaaacaaatctacttttggtgctaacgctattttggcggtttctttagcagtggcgaaa
gcagcggcaatttctaaaaaagtaccattatatgcccacattgcagacatcaatggtact
ccaggtgtttactcaatgcctgtacctatgatgaacatcatcaatggtggtgagcacgca
gacaacaacgttgatattcaagagttcatgattcaaccagttggtgcaccaaatttccgt
gaagctttgcgctatggtgctgaaattttccatgcactgaaaaaagtattgagcgatcgt
ggtttaagtactgcggttggtgatgagggtggttttgcacctgatctgtcatctaatgct
gaagcattggctgttatcaaagaagcggttgctgcagcaggctacgagctaggtaaagac
attactttggcgatggattgtgctgcctctgagttttacgacaaagaagcaaatatctac
gaccttaaaggtgaaggtaaaaagttcacctcagaagagttcaacttcttcctacaagac
cttactaagcaatatccgattgtttctatcgaagatggtcttgatgagtctgactgggat
ggtttcgcacatcaaactaaactaatgggtgataaaatccaattagtgggtgatgatctg
ttcgttactaacactaagattctgcagcgtggtatcgataatggtattgcgaattcaatc
ttaatcaagtttaaccaaatcggttctttaactgagacgttggctgctattaaaatggca
aaagacgctggttttacagcagttatttctcaccgttctggtgaaacagaagacgcgact
attgcagatcttgcagttggtactgcggctggtcaaattaaaacgggttcactatgccgc
tctgaccgtgttgctaagtacaaccaattgttacgtatagaagagcaattaggtggtaaa
gcaccttataaaggtcgttctgagatcaaaggtcaggcttaa

DBGET integrated database retrieval system