KEGG   Marinomonas sp. MWYL1: Mmwyl1_1299Help
Entry
Mmwyl1_1299       CDS       T00567                                 

Definition
(RefSeq) phosphopyruvate hydratase (EC:4.2.1.11)
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
RNA degradosome
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_1299
   01230 Biosynthesis of amino acids
    Mmwyl1_1299
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_1299
  Energy metabolism
   00680 Methane metabolism
    Mmwyl1_1299
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mmwyl1_1299
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Mmwyl1_1299
Messenger RNA biogenesis [BR:mmw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mmwyl1_1299
Exosome [BR:mmw04147]
 Exosomal proteins
  Proteins found in most exosomes
   Mmwyl1_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1454099..1455400
Genome map
AA seq 433 aa AA seqDB search
MSQIVDIKAREVLDSRGNPTVEADVILADGSVGSACAPSGASTGSREALELRDGDKSRYL
GKGVLKAVAAVNGPIRDALIGKDALAQAEIDHIMIDLDGTENKSTFGANAILAVSLAVAK
AAAISKKVPLYAHIADINGTPGVYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAPNFR
EALRYGAEIFHALKKVLSDRGLSTAVGDEGGFAPDLSSNAEALAVIKEAVAAAGYELGKD
ITLAMDCAASEFYDKEANIYDLKGEGKKFTSEEFNFFLQDLTKQYPIVSIEDGLDESDWD
GFAHQTKLMGDKIQLVGDDLFVTNTKILQRGIDNGIANSILIKFNQIGSLTETLAAIKMA
KDAGFTAVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEEQLGGK
APYKGRSEIKGQA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatcgttgatattaaagccagagaagttttagattctcgtggtaatcctact
gttgaagccgatgttattttggcagatggctccgtaggttcagcgtgtgcaccgtctggt
gcctctaccggttctcgtgaagctttagaattgcgtgatggcgacaaaagtcgttatcta
ggcaaaggcgtattaaaagcagttgctgcggttaatggcccaatccgtgacgcattgatt
ggcaaagatgcccttgctcaagctgaaattgatcatattatgattgatcttgatggtaca
gaaaacaaatctacttttggtgctaacgctattttggcggtttctttagcagtggcgaaa
gcagcggcaatttctaaaaaagtaccattatatgcccacattgcagacatcaatggtact
ccaggtgtttactcaatgcctgtacctatgatgaacatcatcaatggtggtgagcacgca
gacaacaacgttgatattcaagagttcatgattcaaccagttggtgcaccaaatttccgt
gaagctttgcgctatggtgctgaaattttccatgcactgaaaaaagtattgagcgatcgt
ggtttaagtactgcggttggtgatgagggtggttttgcacctgatctgtcatctaatgct
gaagcattggctgttatcaaagaagcggttgctgcagcaggctacgagctaggtaaagac
attactttggcgatggattgtgctgcctctgagttttacgacaaagaagcaaatatctac
gaccttaaaggtgaaggtaaaaagttcacctcagaagagttcaacttcttcctacaagac
cttactaagcaatatccgattgtttctatcgaagatggtcttgatgagtctgactgggat
ggtttcgcacatcaaactaaactaatgggtgataaaatccaattagtgggtgatgatctg
ttcgttactaacactaagattctgcagcgtggtatcgataatggtattgcgaattcaatc
ttaatcaagtttaaccaaatcggttctttaactgagacgttggctgctattaaaatggca
aaagacgctggttttacagcagttatttctcaccgttctggtgaaacagaagacgcgact
attgcagatcttgcagttggtactgcggctggtcaaattaaaacgggttcactatgccgc
tctgaccgtgttgctaagtacaaccaattgttacgtatagaagagcaattaggtggtaaa
gcaccttataaaggtcgttctgagatcaaaggtcaggcttaa

DBGET integrated database retrieval system