KEGG   Marinomonas sp. MWYL1: Mmwyl1_1299Help
Entry
Mmwyl1_1299       CDS       T00567                                 

Definition
phosphopyruvate hydratase (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
RNA degradosome
Class
Metabolism; Overview; Carbon metabolism [PATH:mmw01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmw01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmw00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:mmw00680]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:mmw03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1454099..1455400
Genome map
AA seq 433 aa AA seqDB search
MSQIVDIKAREVLDSRGNPTVEADVILADGSVGSACAPSGASTGSREALELRDGDKSRYL
GKGVLKAVAAVNGPIRDALIGKDALAQAEIDHIMIDLDGTENKSTFGANAILAVSLAVAK
AAAISKKVPLYAHIADINGTPGVYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAPNFR
EALRYGAEIFHALKKVLSDRGLSTAVGDEGGFAPDLSSNAEALAVIKEAVAAAGYELGKD
ITLAMDCAASEFYDKEANIYDLKGEGKKFTSEEFNFFLQDLTKQYPIVSIEDGLDESDWD
GFAHQTKLMGDKIQLVGDDLFVTNTKILQRGIDNGIANSILIKFNQIGSLTETLAAIKMA
KDAGFTAVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEEQLGGK
APYKGRSEIKGQA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatcgttgatattaaagccagagaagttttagattctcgtggtaatcctact
gttgaagccgatgttattttggcagatggctccgtaggttcagcgtgtgcaccgtctggt
gcctctaccggttctcgtgaagctttagaattgcgtgatggcgacaaaagtcgttatcta
ggcaaaggcgtattaaaagcagttgctgcggttaatggcccaatccgtgacgcattgatt
ggcaaagatgcccttgctcaagctgaaattgatcatattatgattgatcttgatggtaca
gaaaacaaatctacttttggtgctaacgctattttggcggtttctttagcagtggcgaaa
gcagcggcaatttctaaaaaagtaccattatatgcccacattgcagacatcaatggtact
ccaggtgtttactcaatgcctgtacctatgatgaacatcatcaatggtggtgagcacgca
gacaacaacgttgatattcaagagttcatgattcaaccagttggtgcaccaaatttccgt
gaagctttgcgctatggtgctgaaattttccatgcactgaaaaaagtattgagcgatcgt
ggtttaagtactgcggttggtgatgagggtggttttgcacctgatctgtcatctaatgct
gaagcattggctgttatcaaagaagcggttgctgcagcaggctacgagctaggtaaagac
attactttggcgatggattgtgctgcctctgagttttacgacaaagaagcaaatatctac
gaccttaaaggtgaaggtaaaaagttcacctcagaagagttcaacttcttcctacaagac
cttactaagcaatatccgattgtttctatcgaagatggtcttgatgagtctgactgggat
ggtttcgcacatcaaactaaactaatgggtgataaaatccaattagtgggtgatgatctg
ttcgttactaacactaagattctgcagcgtggtatcgataatggtattgcgaattcaatc
ttaatcaagtttaaccaaatcggttctttaactgagacgttggctgctattaaaatggca
aaagacgctggttttacagcagttatttctcaccgttctggtgaaacagaagacgcgact
attgcagatcttgcagttggtactgcggctggtcaaattaaaacgggttcactatgccgc
tctgaccgtgttgctaagtacaaccaattgttacgtatagaagagcaattaggtggtaaa
gcaccttataaaggtcgttctgagatcaaaggtcaggcttaa

DBGET integrated database retrieval system