KEGG   Marinomonas sp. MWYL1: Mmwyl1_1299Help
Entry
Mmwyl1_1299       CDS       T00567                                 

Definition
phosphopyruvate hydratase (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
RNA degradosome
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_1299
   01230 Biosynthesis of amino acids
    Mmwyl1_1299
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_1299
  Energy metabolism
   00680 Methane metabolism
    Mmwyl1_1299
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mmwyl1_1299
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Mmwyl1_1299
Messenger RNA biogenesis [BR:mmw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mmwyl1_1299
Exosome [BR:mmw04147]
 Exosomal proteins
  Proteins found in most exosomes
   Mmwyl1_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1454099..1455400
Genome map
AA seq 433 aa AA seqDB search
MSQIVDIKAREVLDSRGNPTVEADVILADGSVGSACAPSGASTGSREALELRDGDKSRYL
GKGVLKAVAAVNGPIRDALIGKDALAQAEIDHIMIDLDGTENKSTFGANAILAVSLAVAK
AAAISKKVPLYAHIADINGTPGVYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAPNFR
EALRYGAEIFHALKKVLSDRGLSTAVGDEGGFAPDLSSNAEALAVIKEAVAAAGYELGKD
ITLAMDCAASEFYDKEANIYDLKGEGKKFTSEEFNFFLQDLTKQYPIVSIEDGLDESDWD
GFAHQTKLMGDKIQLVGDDLFVTNTKILQRGIDNGIANSILIKFNQIGSLTETLAAIKMA
KDAGFTAVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEEQLGGK
APYKGRSEIKGQA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatcgttgatattaaagccagagaagttttagattctcgtggtaatcctact
gttgaagccgatgttattttggcagatggctccgtaggttcagcgtgtgcaccgtctggt
gcctctaccggttctcgtgaagctttagaattgcgtgatggcgacaaaagtcgttatcta
ggcaaaggcgtattaaaagcagttgctgcggttaatggcccaatccgtgacgcattgatt
ggcaaagatgcccttgctcaagctgaaattgatcatattatgattgatcttgatggtaca
gaaaacaaatctacttttggtgctaacgctattttggcggtttctttagcagtggcgaaa
gcagcggcaatttctaaaaaagtaccattatatgcccacattgcagacatcaatggtact
ccaggtgtttactcaatgcctgtacctatgatgaacatcatcaatggtggtgagcacgca
gacaacaacgttgatattcaagagttcatgattcaaccagttggtgcaccaaatttccgt
gaagctttgcgctatggtgctgaaattttccatgcactgaaaaaagtattgagcgatcgt
ggtttaagtactgcggttggtgatgagggtggttttgcacctgatctgtcatctaatgct
gaagcattggctgttatcaaagaagcggttgctgcagcaggctacgagctaggtaaagac
attactttggcgatggattgtgctgcctctgagttttacgacaaagaagcaaatatctac
gaccttaaaggtgaaggtaaaaagttcacctcagaagagttcaacttcttcctacaagac
cttactaagcaatatccgattgtttctatcgaagatggtcttgatgagtctgactgggat
ggtttcgcacatcaaactaaactaatgggtgataaaatccaattagtgggtgatgatctg
ttcgttactaacactaagattctgcagcgtggtatcgataatggtattgcgaattcaatc
ttaatcaagtttaaccaaatcggttctttaactgagacgttggctgctattaaaatggca
aaagacgctggttttacagcagttatttctcaccgttctggtgaaacagaagacgcgact
attgcagatcttgcagttggtactgcggctggtcaaattaaaacgggttcactatgccgc
tctgaccgtgttgctaagtacaaccaattgttacgtatagaagagcaattaggtggtaaa
gcaccttataaaggtcgttctgagatcaaaggtcaggcttaa

DBGET integrated database retrieval system