KEGG   Marinomonas sp. MWYL1: Mmwyl1_1463Help
Entry
Mmwyl1_1463       CDS       T00567                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1637986..1640181)
Genome map
AA seq 731 aa AA seqDB search
MDLIKNALINDVLNAHCSDPFGCLGLQSSPSKKGLSLLVWQPEAISIRVLAIDSDKVLAT
MSETNDKGLFHAEWPKENTRFHYRLEITYKDESTYTLVDPYQFPSTTFVDPKHHQANQYK
SQGAIRAGAKVNDKLTIQGTRFAVYAPAARSVSVVGDFNAWDGRIHPMSSNGDGIWRLFI
PDVNHGARYKFEIRAKSGEILPHRSDPYAQRIEQYPSFASVTCFDNKHVWQDDAWVKRPI
EDIYERPMSIYELHIGSWRRKGDNQPLTYLEMKDQLVPYIQEMGYTHVELLPITEYPFDG
SWGYQPVGLYAVTSRFGTPEDFKALVDALHQANIGVIMDWVPAHFPADSHGLANFDGSKQ
YEYPDPKKGWHPEWNSLIYDFGKEHVVNYLISNAVYWLEEFHIDGLRVDAVASMLYLDYS
REDGEWIPNKDGGNHNYEAIDFLRRLNETVYLNHPRCFTVAEESTAFPGVSKPTYMNGLG
FGFKWNMGWMNDSLAYIKRDPIYRQHHQGELSFSMVYAFDEQFVLPISHDEVVHGKGSMI
TKMPGDAWQKFANLRAFSAYMYFHPGKKLNFMGNEFAQGQEWSHERSLDWHLLDTDFHKA
QQTLSKDLNHLYKNEASLQFDHSYLGFEWISYDDSANSILAFARKAKDSDEHAVAVINFT
PTPHGNYRIGVPKAGRYQVIIDTDETSYTGSGFAKSKEYDTQTIVSHGRDQSIELQVPPL
AGVLLKWLGES
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggatttaataaaaaacgccctaattaacgatgtgctgaatgcacattgttcagacccc
tttggctgtttaggactacaatcatcaccatctaaaaaaggtttgtcgctactggtttgg
caaccggaagcgatttctattcgtgtattggccatagattcagacaaagtgctcgctaca
atgagcgaaaccaatgacaaaggcctgtttcacgccgaatggccaaaagaaaacacgcgt
tttcattatcgtcttgaaattacttataaagacgaaagcacttatacgctggttgaccca
taccagttccctagtacgacctttgttgaccccaaacatcatcaagcgaaccagtacaaa
agccaaggcgcgattcgcgctggtgctaaggtaaacgataagctcaccattcaaggcaca
cgttttgcggtttatgcaccagcagcccgatccgtatctgtcgttggcgactttaatgct
tgggatggtcgcattcatcctatgtcgagcaacggtgatggtatttggcgactgtttatt
ccagacgttaatcacggtgctcgttataaattcgagattcgcgcgaaatccggcgagatt
cttcctcatcgcagtgatccatatgcacagcgtattgaacaatatccatcctttgccagc
gtaacctgttttgataataagcacgtatggcaagacgacgcttgggttaaacgccctatc
gaagacatctatgaaagacccatgagcatttatgaattgcacataggttcatggcgtcgc
aaaggtgacaatcaaccgctgacgtatcttgaaatgaaagatcagctggttccttatatt
caagaaatgggctacacacacgtcgaattattgccgattactgaatacccattcgatgga
tcttggggctatcagcctgtcggtttgtatgctgtaacatctcgatttggtacaccagaa
gatttcaaagcccttgtcgatgcgcttcatcaagccaacattggtgtgatcatggattgg
gttcctgcgcattttccagccgacagccacggtttagcaaacttcgatggttccaaacaa
tacgaatacccagaccctaaaaaaggttggcatccagaatggaattcgctgatctatgat
tttggtaaagagcatgtagtgaattacctaatcagtaatgcggtttattggttagaagaa
ttccacatcgatggtttgcgcgttgatgctgtggcatctatgttgtatttggattattcc
cgtgaagacggtgaatggattcctaacaaagatggtggcaatcataactacgaagccatt
gattttttacgccgtttaaacgaaaccgtgtacttgaatcatccgcgctgctttaccgta
gccgaagaatctaccgcctttccaggtgtgtctaaaccaacttatatgaatggtttgggc
tttggcttcaaatggaacatgggctggatgaacgactcgcttgcatatataaagcgcgat
ccgatttatcgccagcatcatcagggcgagcttagctttagtatggtgtacgcctttgat
gagcaatttgttctgccgatatctcacgatgaagtggtacatggcaaaggctcgatgatc
actaaaatgcccggagatgcttggcagaaattcgctaatttacgcgcattttcggcttac
atgtatttccatcctggcaagaaactcaacttcatgggtaacgagtttgcacaaggtcaa
gaatggagccatgaacgctctttggattggcacttgttagacacagatttccataaggct
cagcaaacgctatcaaaagacttaaaccatctttataaaaatgaagcgagtttgcagttt
gatcattcttatctaggctttgaatggatcagctacgatgacagcgccaacagtattttg
gcctttgcccgtaaagccaaagacagtgatgaacacgcggtcgctgtgattaactttaca
ccaaccccccatggcaactaccgaattggtgtgccaaaagcaggtcgttaccaagtcatc
atagatacggatgagacaagctatactggcagtggctttgccaaaagcaaagaatacgat
acgcaaactattgtcagccatggccgtgatcaaagtattgaactgcaagtaccaccactt
gctggcgttttattaaaatggctaggcgagtcttaa

DBGET integrated database retrieval system