KEGG   Marinomonas sp. MWYL1: Mmwyl1_1534Help
Entry
Mmwyl1_1534       CDS       T00567                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mmwyl1_1534
Enzymes [BR:mmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mmwyl1_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1717318..1718211
Genome map
AA seq 297 aa AA seqDB search
MTIYNFGSINLDHLYQLDHFVRPGETMASNSYQCLLGGKGANQSVALAKAGADVKHVGAI
HHSDQAVIDQLESLGVDTGLIKRIDVPTGHAIIQLTKEAENSIILYQGANHALTEEQVDQ
VLSQANAGDWVLLQNETNLIEYIMRKAQENKLKVAFNPAPMDAELTKEVLGFVDLLIVNE
VEAMDLIGTKDIDSTIEAFPKAYPDLEVLMTLGKAGVCYFSGDESVKVKAFSVEAVDTTA
AGDTFIGFCLSSLMNGEDMTQAITRACAASAICVTRLGAASSIPTQDEVTAFLARNR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttataactttggttcgattaacctcgaccacctttatcagctagatcatttt
gttcgccctggtgagactatggcttctaatagctatcagtgtttattaggtggcaaagga
gcaaaccaatcggttgcactggctaaagcgggcgctgatgtaaagcatgtcggggcgatt
catcatagtgatcaagctgttattgatcagctagaatcccttggagtggatacggggttg
ataaagcggattgatgtgccaacaggccatgcgattattcagctaactaaagaagcagaa
aattcgattattttgtaccaaggcgcaaaccatgcgttgacggaagaacaagttgatcaa
gtgctatcacaggcaaacgctggtgattgggtgttgttgcaaaatgaaaccaaccttatc
gaatacattatgcgtaaagcgcaagagaataagcttaaggttgcatttaatccagctcca
atggatgccgaacttaccaaggaggttcttggctttgttgatttgttgattgttaacgaa
gtggaagccatggatttaatcggtacaaaagatatcgatagcaccattgaggcttttcca
aaagcctaccctgatttagaagtgttgatgacccttgggaaagctggggtttgttatttt
agcggtgatgaaagcgtgaaggtaaaagccttttctgtagaagccgttgataccacagcg
gctggagatacgtttattggcttttgcttgtcttctctaatgaatggcgaagacatgacg
caggcgatcactcgtgcatgtgctgcatctgctatttgcgttactcgtttaggtgctgcg
tcatctataccaacacaagatgaagtgacggcctttcttgccaggaaccgttag

DBGET integrated database retrieval system