KEGG   Marinomonas sp. MWYL1: Mmwyl1_1578Help
Entry
Mmwyl1_1578       CDS       T00567                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_1578 (fadB)
   01212 Fatty acid metabolism
    Mmwyl1_1578 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mmwyl1_1578 (fadB)
   00650 Butanoate metabolism
    Mmwyl1_1578 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Mmwyl1_1578 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Mmwyl1_1578 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmwyl1_1578 (fadB)
   00310 Lysine degradation
    Mmwyl1_1578 (fadB)
   00380 Tryptophan metabolism
    Mmwyl1_1578 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmwyl1_1578 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mmwyl1_1578 (fadB)
   00281 Geraniol degradation
    Mmwyl1_1578 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Mmwyl1_1578 (fadB)
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mmwyl1_1578 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mmwyl1_1578 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mmwyl1_1578 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Mmwyl1_1578 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1761327..1763477
Genome map
AA seq 716 aa AA seqDB search
MIFEGQAVKVAVDDAGVATVTLDLVGESVNKFNSLTLNELAEAVTALKHIDDLQGVIFAS
AKDVFVVGADITEFTSWFKLEDDDLADKLRHAHSIFNDISNLCCPTVAAINGIALGGGME
LALACDYRVMADTAKIGLPETQLGIYPGWGGTVRLPRLIGADNACEWICGGAQKRSEDAF
KDGAVDAVVPAAKVNESARHLIQQVLDGKLNYHARRDELRAPMEFTPIEKMMVFESVRGV
VGAKAGKHYPAPMAAIKTIEKGISQDMEKALDTEIKGFIKLAKGPVAKSLVNLFLSDQQI
KKTAGRYAKNATPVKQAAVLGAGIMGGGVAYQSASKGTPIIMKDIRPEALELGLSEANKL
FNGQVERGRLTTEKAFKAMNAIIPALSYGEFEHVDLVVEAVVENVKIKKSVLAEVETKIS
DDAILTSNTSTISITELAKDLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDAAIAKTVA
YAQAMGKTPVVVNDCPGFLVNRVLFPYFAGFSLMMQEGADFQVVDKTMEKFGWPMGPAYL
LDVVGIDTAYHADQVMAEGFPDRMKHEGTNAVDCLFELERFGQKNGKGFYTYEPDRKGKP
KKIFNEEIDVLLSSIVVSKSELSEDDIVARMMIPLCIETVRCLEENIVASAAEADMGLIY
GIGFPPYLGGALHYLDQMGLQAFCDLADKYSHLGKLYEPTAKMREMAKNNDTYYGA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgattttcgaaggacaagcagtcaaggttgcagtcgatgatgccggcgtagcaaccgtt
actctggatttggtcggtgaatcggtcaataaattcaatagtcttaccttgaatgaattg
gccgaagccgttactgcgctaaaacacattgatgacttacaaggtgttatttttgccagt
gcaaaagatgtttttgtcgtaggtgcggacattaccgaatttacctcttggttcaagctt
gaggatgatgatttagccgataaattgcgtcacgctcacagcatttttaatgacatctct
aatctatgttgcccaacggtagccgctattaatggtattgctcttggtggcggcatggag
ttggccttggcctgtgattatcgcgtgatggctgacactgcgaaaatcggtttaccagaa
actcaactgggtatttaccctggttggggtggtaccgttcgcttacctcgtttaatcggt
gccgataacgcttgtgagtggatttgtggtggtgctcagaaacgcagcgaagatgctttt
aaagatggtgcggttgatgcggttgtgcctgcagcgaaagtcaatgagtcagctcgtcat
cttattcagcaagtgctggatggaaagttgaactatcacgctcgtcgtgatgaattacgc
gcaccaatggaatttactcctattgaaaaaatgatggttttcgaatcggtacgcggtgta
gttggtgcgaaagcgggtaaacattaccctgcgccaatggctgcgattaaaaccattgaa
aaaggcatcagccaagatatggaaaaagcccttgataccgaaatcaaaggttttattaaa
cttgctaagggcccagtagcgaaatctttagtgaacttatttttaagtgatcaacagatt
aagaaaacggcaggcagatacgctaaaaatgcgacgccagttaagcaagctgcggtatta
ggtgcaggtattatgggtggtggtgttgcctatcagtctgcgtcaaaaggcacaccaatt
atcatgaaagatattcgtcctgaagccctagagttaggtttgagcgaagcgaataagcta
ttcaatggtcaagtagagcgcggacgtttaacaaccgaaaaagcttttaaagcaatgaac
gcaattattcctgctttgagctatggcgaatttgaacatgttgatctagtagtcgaagcg
gttgttgaaaacgttaaaatcaaaaaatctgttttggctgaagtagaaactaagatctca
gacgacgctattttgacgtctaatacttcaactatttccattactgaattggcaaaagat
ctaaaacgcccagaaaatttctgtggtatgcatttcttcaaccctgtgcaccgtatgcct
ttggtcgaagttattcgcggtgaaaaaaccagcgatgctgcaattgccaaaacggttgct
tatgcacaagctatgggtaaaacacctgttgtggtaaatgactgtccagggttcctagtt
aaccgtgtgttgttcccttactttgctggtttctccttgatgatgcaggaaggcgcggat
ttccaagtggtagataaaaccatggaaaaattcggttggccaatggggcctgcttatttg
cttgacgtggttggtatcgatacggcttatcatgcggatcaagttatggcagaaggcttt
ccagatcgaatgaagcatgaaggcacaaacgcagtagattgtttgttcgagttagagcgt
tttggtcagaaaaacggtaaaggtttttatacttacgaaccagatcgtaaaggtaaaccg
aagaaaatctttaatgaagaaatcgatgttttactttcttccatagttgtgtcgaagtct
gagttgagcgaagacgacatagtggcacggatgatgattccactttgtattgaaacagta
cgttgccttgaagaaaatatcgtggcatcggcggcagaagcagacatgggattgatttac
ggtattggtttccctccataccttggcggtgctttgcactacttagatcaaatgggactg
caggccttttgtgaccttgcagataaatacagccacttaggtaagttgtacgagccaacc
gcaaaaatgcgtgaaatggcgaagaataacgacacttattacggcgcataa

DBGET integrated database retrieval system