KEGG   Marinomonas sp. MWYL1: Mmwyl1_1578Help
Entry
Mmwyl1_1578       CDS       T00567                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00071  Fatty acid degradation
mmw00280  Valine, leucine and isoleucine degradation
mmw00281  Geraniol degradation
mmw00310  Lysine degradation
mmw00362  Benzoate degradation
mmw00380  Tryptophan metabolism
mmw00410  beta-Alanine metabolism
mmw00640  Propanoate metabolism
mmw00650  Butanoate metabolism
mmw00903  Limonene and pinene degradation
mmw00930  Caprolactam degradation
mmw01040  Biosynthesis of unsaturated fatty acids
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
mmw01200  Carbon metabolism
mmw01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mmwyl1_1578
   00650 Butanoate metabolism
    Mmwyl1_1578
  Lipid metabolism
   00071 Fatty acid degradation
    Mmwyl1_1578
   01040 Biosynthesis of unsaturated fatty acids
    Mmwyl1_1578
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmwyl1_1578
   00310 Lysine degradation
    Mmwyl1_1578
   00380 Tryptophan metabolism
    Mmwyl1_1578
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmwyl1_1578
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mmwyl1_1578
   00281 Geraniol degradation
    Mmwyl1_1578
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmwyl1_1578
   00930 Caprolactam degradation
    Mmwyl1_1578
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mmwyl1_1578
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mmwyl1_1578
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mmwyl1_1578
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Mmwyl1_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABR70506
JGI: Mmwyl11578
UniProt: A6VVM7
Position
1761327..1763477
Genome map
AA seq 716 aa AA seqDB search
MIFEGQAVKVAVDDAGVATVTLDLVGESVNKFNSLTLNELAEAVTALKHIDDLQGVIFAS
AKDVFVVGADITEFTSWFKLEDDDLADKLRHAHSIFNDISNLCCPTVAAINGIALGGGME
LALACDYRVMADTAKIGLPETQLGIYPGWGGTVRLPRLIGADNACEWICGGAQKRSEDAF
KDGAVDAVVPAAKVNESARHLIQQVLDGKLNYHARRDELRAPMEFTPIEKMMVFESVRGV
VGAKAGKHYPAPMAAIKTIEKGISQDMEKALDTEIKGFIKLAKGPVAKSLVNLFLSDQQI
KKTAGRYAKNATPVKQAAVLGAGIMGGGVAYQSASKGTPIIMKDIRPEALELGLSEANKL
FNGQVERGRLTTEKAFKAMNAIIPALSYGEFEHVDLVVEAVVENVKIKKSVLAEVETKIS
DDAILTSNTSTISITELAKDLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDAAIAKTVA
YAQAMGKTPVVVNDCPGFLVNRVLFPYFAGFSLMMQEGADFQVVDKTMEKFGWPMGPAYL
LDVVGIDTAYHADQVMAEGFPDRMKHEGTNAVDCLFELERFGQKNGKGFYTYEPDRKGKP
KKIFNEEIDVLLSSIVVSKSELSEDDIVARMMIPLCIETVRCLEENIVASAAEADMGLIY
GIGFPPYLGGALHYLDQMGLQAFCDLADKYSHLGKLYEPTAKMREMAKNNDTYYGA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgattttcgaaggacaagcagtcaaggttgcagtcgatgatgccggcgtagcaaccgtt
actctggatttggtcggtgaatcggtcaataaattcaatagtcttaccttgaatgaattg
gccgaagccgttactgcgctaaaacacattgatgacttacaaggtgttatttttgccagt
gcaaaagatgtttttgtcgtaggtgcggacattaccgaatttacctcttggttcaagctt
gaggatgatgatttagccgataaattgcgtcacgctcacagcatttttaatgacatctct
aatctatgttgcccaacggtagccgctattaatggtattgctcttggtggcggcatggag
ttggccttggcctgtgattatcgcgtgatggctgacactgcgaaaatcggtttaccagaa
actcaactgggtatttaccctggttggggtggtaccgttcgcttacctcgtttaatcggt
gccgataacgcttgtgagtggatttgtggtggtgctcagaaacgcagcgaagatgctttt
aaagatggtgcggttgatgcggttgtgcctgcagcgaaagtcaatgagtcagctcgtcat
cttattcagcaagtgctggatggaaagttgaactatcacgctcgtcgtgatgaattacgc
gcaccaatggaatttactcctattgaaaaaatgatggttttcgaatcggtacgcggtgta
gttggtgcgaaagcgggtaaacattaccctgcgccaatggctgcgattaaaaccattgaa
aaaggcatcagccaagatatggaaaaagcccttgataccgaaatcaaaggttttattaaa
cttgctaagggcccagtagcgaaatctttagtgaacttatttttaagtgatcaacagatt
aagaaaacggcaggcagatacgctaaaaatgcgacgccagttaagcaagctgcggtatta
ggtgcaggtattatgggtggtggtgttgcctatcagtctgcgtcaaaaggcacaccaatt
atcatgaaagatattcgtcctgaagccctagagttaggtttgagcgaagcgaataagcta
ttcaatggtcaagtagagcgcggacgtttaacaaccgaaaaagcttttaaagcaatgaac
gcaattattcctgctttgagctatggcgaatttgaacatgttgatctagtagtcgaagcg
gttgttgaaaacgttaaaatcaaaaaatctgttttggctgaagtagaaactaagatctca
gacgacgctattttgacgtctaatacttcaactatttccattactgaattggcaaaagat
ctaaaacgcccagaaaatttctgtggtatgcatttcttcaaccctgtgcaccgtatgcct
ttggtcgaagttattcgcggtgaaaaaaccagcgatgctgcaattgccaaaacggttgct
tatgcacaagctatgggtaaaacacctgttgtggtaaatgactgtccagggttcctagtt
aaccgtgtgttgttcccttactttgctggtttctccttgatgatgcaggaaggcgcggat
ttccaagtggtagataaaaccatggaaaaattcggttggccaatggggcctgcttatttg
cttgacgtggttggtatcgatacggcttatcatgcggatcaagttatggcagaaggcttt
ccagatcgaatgaagcatgaaggcacaaacgcagtagattgtttgttcgagttagagcgt
tttggtcagaaaaacggtaaaggtttttatacttacgaaccagatcgtaaaggtaaaccg
aagaaaatctttaatgaagaaatcgatgttttactttcttccatagttgtgtcgaagtct
gagttgagcgaagacgacatagtggcacggatgatgattccactttgtattgaaacagta
cgttgccttgaagaaaatatcgtggcatcggcggcagaagcagacatgggattgatttac
ggtattggtttccctccataccttggcggtgctttgcactacttagatcaaatgggactg
caggccttttgtgaccttgcagataaatacagccacttaggtaagttgtacgagccaacc
gcaaaaatgcgtgaaatggcgaagaataacgacacttattacggcgcataa

DBGET integrated database retrieval system