KEGG   Marinomonas sp. MWYL1: Mmwyl1_1615Help
Entry
Mmwyl1_1615       CDS       T00567                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mmwyl1_1615
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mmwyl1_1615
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mmwyl1_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1808481..1810052
Genome map
AA seq 523 aa AA seqDB search
MGEYNIFRANVRANSAEELSLIDTIQPGAVTKFVGQDLDTEVKMMNQLRSHSVIPLLVSG
DLEGGGMSFPFGAQVPNQLGLAGLKDESAVEYCTQVIAQEAKLLGINWSFTPVVDINAKF
RSAVVGTRSYGSDVDVIETMSRSNITTFQKNGIAATAKHWPGEGFDDRDQHLVTTVNPLT
MSEWEERYGRLYRSAIDNNVMSIMSAHIALPEYVKAHEDNPAEWWRPASVSKLLNEQLLR
GELGFNGLIVSDATVMAGLSSWTKRENVVAEIIENGCDMLLFCKDPVEDYAYMLKAVREG
RVSETRLEQSVMRILAMKAALGLHEKQEEISSSKFNDLLASDYADRIPELNRRTVHLVKN
RDDILPINLERHQRVLVVSTGIRHVFSPIPAPLSVANMLKNEGFEVTEFQTGMALNVKEY
DLLLYLNADESMLVKSHIYIDWMVLHGGFGNAMYRPWVDIPTVMVSFGHPYLLYDAPKVP
VYINAYSPLLEVQKAVVEGLLGRLSFNSNAAIDPFCGLEQLRY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgaatacaacatattcagagctaacgttagagcaaattctgcagaagagttatct
cttattgatacgattcagcctggtgcggtgactaagtttgtcgggcaagatcttgatacc
gaagtaaagatgatgaatcagctgcgcagtcattctgtcattccgcttttggtgagtggt
gaccttgaaggcggtggcatgagctttcctttcggtgctcaagtaccaaaccagcttggt
cttgctgggttgaaagatgagagtgcggtggaatattgtacccaagtaattgctcaagaa
gctaaattgcttggcattaactggtcatttactccggttgttgatatcaacgctaagttt
cgtagtgctgtcgtaggtacacgatcatatggtagtgatgttgatgttatcgagactatg
agtcgctcgaatattactactttccaaaaaaacggtattgcagcaacggcaaagcattgg
ccgggggaggggttcgacgaccgagatcagcatctagtcaccacagtaaatccattaact
atgtccgaatgggaggagcgttatggacgactttaccgtagtgcgattgacaataatgtg
atgtcgattatgtccgctcacattgctttgcctgaatatgtaaaggctcatgaggacaac
ccagcagagtggtggcgtccggcaagtgttagtaagctgctcaatgaacagctcttgcgt
ggagagctgggctttaatggtttaattgtctcagatgctactgtgatggcgggtttgagt
agctggacgaaacgtgaaaacgtggttgctgagatcattgaaaacggttgtgacatgctg
ttgttttgcaaggacccggtcgaagattacgcttatatgcttaaagccgtgcgtgaaggt
agagtatctgaaacacgtttagagcaatctgttatgcgaatcttagcgatgaaagccgct
ttgggcttgcacgaaaagcaagaggagattagttctagtaaatttaatgatctgttggca
tcggattacgcggaccgaattcccgagttgaatcgtcgcacggtgcatttggtaaaaaac
cgcgatgatattttaccaatcaatttagagcgtcatcagcgtgtgttggttgtttctact
ggtattcgacatgtttttagtcctattcctgcgccattaagtgtggctaacatgctgaaa
aatgaaggctttgaagtcacagagtttcaaacaggaatggcattaaacgtgaaagagtat
gatttgttactctatcttaacgctgatgaatctatgttggtgaagtcgcatatttatatt
gattggatggtactacatggcggttttggtaatgccatgtatcgtccgtgggtcgatatt
ccgacggtaatggtgtcttttggtcatccttatcttttgtacgacgcgcctaaagtgcca
gtatacattaatgcctatagccctttattggaggttcagaaggcggtcgtagaaggcttg
ttaggacggttaagctttaattctaatgctgctattgatcctttctgtgggttagagcaa
ctacgttattga

DBGET integrated database retrieval system