KEGG   Marinomonas sp. MWYL1: Mmwyl1_1661Help
Entry
Mmwyl1_1661       CDS       T00567                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00260  Glycine, serine and threonine metabolism
mmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01130  Biosynthesis of antibiotics
mmw01230  Biosynthesis of amino acids
Module
mmw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmwyl1_1661
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmwyl1_1661
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmwyl1_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABR70587
JGI: Mmwyl11661
UniProt: A6VVV8
Position
complement(1867109..1867894)
Genome map
AA seq 261 aa AA seqDB search
MSQLATFIAEKRQNKPILSMTHVVYGYPSVEESLNWMEKLMEEGVDFIEVQFPFSDPVAD
GPSIVAACHKALEQKLDVETCLSQLGKIAKNFPDSRIVLMSYLNPMYRFGLDKLAKRAAE
ENILGLILPDLPIEQAATYQSACKANNIDPVWLVTPVTPPDRLAMLANQASGFLYCVARS
GVTGHSSHEGKAKQTSLDDYLAQIKQHASAPMGVGFGIRERAQIEQLTGKADIAIIGSAL
LDAYNQGGQEAGIKLIKDLFH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttagcgacttttatcgcagaaaaacgccaaaacaagccaattttatccatg
acccatgtggtttatgggtacccaagtgttgaagaaagcttgaactggatggaaaaattg
atggaggaaggggtggacttcatcgaagtacaatttcctttttccgatcctgtcgccgac
ggcccaagtattgttgctgcttgtcataaagcattagagcaaaagctggacgtggaaact
tgcttgtctcaactaggaaaaatagcaaaaaactttcctgacagccgcattgtgttgatg
agctacttaaatccaatgtaccgctttggcttagacaaattagccaaacgcgcggcagaa
gaaaacattctggggttaatccttccagatctaccaattgagcaagccgctacttatcaa
tcggcttgtaaagccaataacatcgatccagtttggttagtaacccctgtgaccccacca
gaccgtttagccatgctagcgaaccaagccagtggtttcttatattgtgtcgctcgctct
ggtgtaactgggcattctagccatgaaggcaaagccaaacagacttcacttgatgactac
ttggcgcagatcaaacaacacgccagcgctccgatgggcgtcggttttggtatacgcgaa
cgtgcccaaatcgaacagctcacaggcaaggcagatattgccattattggttctgccctc
ttagatgcctacaaccaaggtggtcaagaagcgggcattaagctaattaaagatttgttt
cactaa

DBGET integrated database retrieval system